Dataset for protein Bfl1 of organism Mus spicilegus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6GN16_BCL2A1-      MSEYEFTYIHSLAEHYLQYVLQVPAFESAPSQAYRLLQRVAFSVQKEVGK
A0A8C6H5H7_BCL2A1-      MTESELMHIHSLAEHYFQYVLQVPAFESAPSKACRVLQRVAFSVQKEVEK
                        *:* *: :********:**************:* *:************ *

A0A8C6GN16_BCL2A1-      NLKSYLDDFHVESIDTARIIFNQVMKKEFEDGIINWGKIVTIFTFGGVLL
A0A8C6H5H7_BCL2A1-      NLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLL
                        *************************:***********.*****:******

A0A8C6GN16_BCL2A1-      KKLPQD--------------FLAEFIMNNTGEWIWQDGDWVS-----FKK
A0A8C6H5H7_BCL2A1-      KKLPQEQIALDVGAYKQVSSFVAEFIMNNTGEWIRRNGGWEDGFIKKFEP
                        *****:              *:************..:*.* .     *: 

A0A8C6GN16_BCL2A1-      SRGFKFFWIIGVLCASLLCKAIISHTVNYKKKKKKKKTTFRESESAGIQG
A0A8C6H5H7_BCL2A1-      KSGWLTFL--------------------------------------QMTG
                        . *:  *                                        : *

A0A8C6GN16_BCL2A1-      TSIDGLHLLRALLLKYGRITQEMR
A0A8C6H5H7_BCL2A1-      QIWEMLFLLK--------------
                           : *.**.              

© 1998-2022Legal notice