Dataset for protein Mcl-1 of organism Microcebus murinus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
        :  * * **                                                               
mfglkrnavigLnLyCGgaglgagssgatppggrll--------------------------------------------
--------lcv y s  -------------------aaekeatarrevgggeagtviggspgasppasltpdarrvarpa
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
pigaevpdvtatperllffaptrravppeemeapaadaimspedeldgyepeplgkrpavlpllelvgeasngsgtegsl
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                            :.:    *   :        
-----------------------------atgakdakpmgrsgaasrkaletlrrvgdgvqrnhqtaFqgmvrkl-----
pstpppaeeeedelyrqsleiisrylreq-------------------------------kkdpmcf lcwlc--dikne
                                                                      l  gv     

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
            : . *  .*                     ::.*   :. .           *   .*.* *: : : 
ddvkslsrvmvhvfsdGvtnWgrivtlisfgafvakhlksinqesCieplaesitdvlvrtkrdWlvkqRgWdGfveffh
------------lpcr prr ---------------------hqk aagfcrcc---------- ---s s f isnkia
n                                                                               

       330       340       350         
....:....|....:....|....:....|....:....
:                                      
vedleggirnvllafagvagvgaglaylir---------
l-----------------------------slvcavmgf
                     a       d         
© 1998-2022Legal notice