Dataset for protein Mcl-1 of organism Microcebus murinus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8B7GKA0_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Microcebus murinus GN=MCL-1 (length=197 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSSGATPPGGRLLATGAKDAKPMGRSGAASRKALETLRRVGDGVQRNHQTAFQGMLR
KLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8B7GKA0_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Microcebus murinus GN=MCL-1 (length=270 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSSGATPPGGRLLAAEKEATARREVGGGEAGTVIGGSPGASPPASLTPDARRVARPA
PIGAEVPDVTATPERLLFFAPTRRAVPPEEMEAPAADAIMSPEDELDGYEPEPLGKRPAVLPLLELVGEASNGSGTEGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPMGRSGAASRKALETLRRVGDGVQRNHQTAFQGWVCGVLPCRG
PRRWHQKCAAGFCRCCWSRSWFGISNKIAL
>gnl|bcl2dbpro|A0A8B7GKA0_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Microcebus murinus GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSSGATPPGGRLLAAEKEATARREVGGGEAGTVIGGSPGASPPASLTPDARRVARPA
PIGAEVPDVTATPERLLFFAPTRRAVPPEEMEAPAADAIMSPEDELDGYEPEPLGKRPAVLPLLELVGEASNGSGTEGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPMGRSGAASRKALETLRRVGDGVQRNHQTAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8C5VC33_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Microcebus murinus GN=MCL-1 (length=141 residues).
LCVLYLSCGKKDPMCFFLCLVRNDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVL
VRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVAAGLAYLIDSLVCAVMGF
© 1998-2022Legal notice