Dataset for protein Mcl-1 of organism Microcebus murinus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5VC33_MCL1-01      --------LCVLYLSCG---------------------------------
A0A8B7GKA0_MCL1-03      MFGLKRNAVIGLNLYCGGAGLGAGSSGATPPGGRLL--------------
A0A8B7GKA0_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSSGATPPGGRLLAAEKEATARREVGG
A0A8B7GKA0_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGAGSSGATPPGGRLLAAEKEATARREVGG
                                :  * * **                                 

A0A8C5VC33_MCL1-01      --------------------------------------------------
A0A8B7GKA0_MCL1-03      --------------------------------------------------
A0A8B7GKA0_MCL1-01      GEAGTVIGGSPGASPPASLTPDARRVARPAPIGAEVPDVTATPERLLFFA
A0A8B7GKA0_MCL1-02      GEAGTVIGGSPGASPPASLTPDARRVARPAPIGAEVPDVTATPERLLFFA
                                                                          

A0A8C5VC33_MCL1-01      --------------------------------------------------
A0A8B7GKA0_MCL1-03      --------------------------------------------------
A0A8B7GKA0_MCL1-01      PTRRAVPPEEMEAPAADAIMSPEDELDGYEPEPLGKRPAVLPLLELVGEA
A0A8B7GKA0_MCL1-02      PTRRAVPPEEMEAPAADAIMSPEDELDGYEPEPLGKRPAVLPLLELVGEA
                                                                          

A0A8C5VC33_MCL1-01      --------------------------------------------------
A0A8B7GKA0_MCL1-03      ---------------------------------------ATGAKDAKPMG
A0A8B7GKA0_MCL1-01      SNGSGTEGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPMG
A0A8B7GKA0_MCL1-02      SNGSGTEGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPMG
                                                                          

A0A8C5VC33_MCL1-01      --------------------KKDPMCFFLCLVR-------NDVKSLSRVM
A0A8B7GKA0_MCL1-03      RSGAASRKALETLRRVGDGVQRNHQTAFQGMLRKLDIKNEDDVKSLSRVM
A0A8B7GKA0_MCL1-01      RSGAASRKALETLRRVGDGVQRNHQTAFQGWVCGV---------------
A0A8B7GKA0_MCL1-02      RSGAASRKALETLRRVGDGVQRNHQTAFQGMLRKLDIKNEDDVKSLSRVM
                                            :.:    *   :                  

A0A8C5VC33_MCL1-01      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
A0A8B7GKA0_MCL1-03      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
A0A8B7GKA0_MCL1-01      --LPCRGPRRW---------------------HQKCAAGFCRCC------
A0A8B7GKA0_MCL1-02      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
                          : . *  .*                     ::.*   :. .       

A0A8C5VC33_MCL1-01      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVAAGLAYLID
A0A8B7GKA0_MCL1-03      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A8B7GKA0_MCL1-01      ----W---SRSWFGISNKIAL-----------------------------
A0A8B7GKA0_MCL1-02      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                            *   .*.* *: : : :                             

A0A8C5VC33_MCL1-01      SLVCAVMGF
A0A8B7GKA0_MCL1-03      ---------
A0A8B7GKA0_MCL1-01      ---------
A0A8B7GKA0_MCL1-02      ---------
                                 

© 1998-2022Legal notice