Dataset for protein Bcl-2 of organism Mastacembelus armatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                              ::  ::   :                       *:  .: : .*      
msseeslsstitdwlfinswwlllpfi---llelyvyhlltkr-----------------nsq appptvvrr ------
 an cnrn                    thdkcdk s  gyvwgfhnvqdedaanngf                  

        90       100       110       120       130       140       150       160
                                                     : :* ::*          :.  :  :.
-------------p------fh-------------------------------vvn gde erlyqpdftemsrqlylts
             -mpfysr  rtaytgpdsvvipqqvwvypsrdpqaaihralre                        
              gc nlq   d sn l qes     rgllq   f    f                            

       170       180       190       200       210       220       230       240
*:.. .* **  : *.                                                                
 taqrr a  idel r----------------------------------------------------------------
                                     dgvnw   iaffefg tvcv                       

       250       260       270       280       290       300       310       320
                                ecaakeemts vdni ewmt eyln pl  wiqdn             

       330       340       350       360       370       380     
             : ::                 .:.*  **: .  :   : *.          
----------dafvemydrqresvfscswpsiktvfg aa  aasitigaylt k----------
        gw-                                             hdtalp   
© 1998-2022Legal notice