Dataset for protein Bcl-2 of organism Mastacembelus armatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                              ::  ::   :                       *:  .: : .*      
---------------------------mllvVaafIvafvlLLymisplispkplklngahvVVTGGSSGIGKCIAIECY
msseeslsstitdwlfinswwlllpfi---llelyvyhlltkr-----------------nsq appptvvrr ------
 an cnrn                    thdkcdk s  gyvwgfhnvqdedaanngf                  
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                     : :* ::*          :.  :  :.
RQGAFITLVARDEtkllqak--kevekfaindkqvvlcisvdvssdynqvesvikqAQEKLG--------PVDMLVNCAG
-------------p------fh-------------------------------vvn gde erlyqpdftemsrqlylts
             -mpfysr  rtaytgpdsvvipqqvwvypsrdpqaaihralre                        
              gc nlq   d sn l qes     rgllq   f    f                            

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*:.. .* **  : *.                                                                
TSVSGKFEEVEVDRFKklmevnylgsvyptravittmkerrmgrimfvssqagqiglfgytayspskfalrglaeslqme
 taqrr a  idel r----------------------------------------------------------------
                                     dgvnw   iaffefg tvcv                       
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ikpyniyvtvayppdtdtpglaeenktkpletklisetsgvcQpeqvAkivvrdavqgnfnssvgpdgymlsaltcgmsp
--------------------------------------------------------------------------------
                                ecaakeemts vdni ewmt eyln pl  wiqdn gw          
                                                       i                        

       330       340       350       360       370       380     
....:....|....:....|....:....|....:....|....:....|....:....|....:
             : ::                 .:.*  **: .  :   : *.          
vtsitealqqiitmglf----------------rtiaLfyLGsfdsivrrcmiQreqsksadkre
----------dafvemydrqresvfscswpsiktvfg aa  aasitigaylt k----------
          -                                             hdtalp   
                                                                 
© 1998-2022Legal notice