Dataset for protein Bcl-2 of organism Mastacembelus armatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3MEY1_BCL2-10      MSSEESLSSTITDWLFINSWWLLLPFIMLLVVAAFIVAFVLLLYMISPLI
A0A3Q3MEY1_BCL2-01      MANECNRN----------------------IVEKYICHKLSKRGYVWGFH
A0A3Q3MEY1_BCL2-03      MSSEESLSSTITDWLFINSWWLLLPFIMLLVVAAFIVAFVLLLYMISPLI
A0A3Q3MEY1_BCL2-04      MSSEESLSSTITDWLFINSWWLLLPFIMLLVVAAFIVAFVLLLYMISPLI
A0A3Q3MEY1_BCL2-05      MSSEESLSSTITDWLFINSWWLLLPFIMLLVVAAFIVAFVLLLYMISPLI
A0A3Q3MEY1_BCL2-09      ---------------------------MLLVVAAFIVAFVLLLYMISPLI
A0A3Q3MEY1_BCL2-06      ---------------------------MLLVVAAFIVAFVLLLYMISPLI
A0A3Q3MEY1_BCL2-08      ----------------------------THLLDLWVYDLLTLL-------
A0A3Q3MEY1_BCL2-02      ---------------------------MLLVVAAFIVAFVLLLYMISPLI
A0A3Q3MEY1_BCL2-07      ---------------------------MLLVVAAFIVAFVLLLYMISPLI
                                                      ::  ::   :          

A0A3Q3MEY1_BCL2-10      SPKPLKLNGAHVVVTGGSSGIGKCIAIECYRQGAFITLVARDEPGCLYSQ
A0A3Q3MEY1_BCL2-01      NVQDEDAANNGSVVAPPPTVVRRC--------------------------
A0A3Q3MEY1_BCL2-03      SPKPLKLNGAHVVVTGGSSGIGKCIAIECYRQGAFITLVARDETKLLQAK
A0A3Q3MEY1_BCL2-04      SPKPLKLNGAHVVVTGGSSGIGKCIAIECYRQGAFITLVARDEPMPFNLR
A0A3Q3MEY1_BCL2-05      SPKPLKLNGAHVVVTGGSSGIGKCIAIECYRQGAFITLVARDETKLLQAK
A0A3Q3MEY1_BCL2-09      SPKPLKLNGAHVVVTGGSSGIGKCIAIECYRQGAFITLVARDETKLLQAK
A0A3Q3MEY1_BCL2-06      SPKPLKLNGAHVVVTGGSSGIGKCIAIECYRQGAFITLVARDETKLLQAK
A0A3Q3MEY1_BCL2-08      ----------NFQVTGGSSGIGKCIAIECYRQGAFITLVARDETKLLQAK
A0A3Q3MEY1_BCL2-02      SPKPLKLNGAHVVVTGGSSGIGKCIAIECYRQGAFITLVARDETKLLQAK
A0A3Q3MEY1_BCL2-07      SPKPLKLNGAHVVVTGGSSGIGKCIAIECYRQGAFITLVARDETKLLQAK
                                     *:  .: : .*                          

A0A3Q3MEY1_BCL2-10      ---------------------------------VKNAQEKLG--------
A0A3Q3MEY1_BCL2-01      --RDASTGPDSESIPQLCRGLPQSDPQAAIHRVLREAGDELERLYQPDFT
A0A3Q3MEY1_BCL2-03      --KEVEKFAINDKQVVLCISVDVSSDYNQVESVIKQAQEKLG--------
A0A3Q3MEY1_BCL2-04      FHKTVYNFLIQVV---LCISVDVSSDYNQVESVIKQAQEKLG--------
A0A3Q3MEY1_BCL2-05      --KEVEKFAINDK---QVWVYLSRSDF----FAVVQAQEKLG--------
A0A3Q3MEY1_BCL2-09      --KEVEKFAINDKQVVLCISVDVSSDYNQVESVIKQAQEKLG--------
A0A3Q3MEY1_BCL2-06      --KEVEKFAINDKQVVLCISVDVSSDYNQVESVIKQAQEKLG--------
A0A3Q3MEY1_BCL2-08      --KEVEKFAINDKQVVLCISVDVSSDYNQVESVIKQAQEKLG--------
A0A3Q3MEY1_BCL2-02      --KEVEKFAINDKQVVLCISVDVSSDYNQVESVIKQAQEKLG--------
A0A3Q3MEY1_BCL2-07      --KEVEKFAINDKQVVLCISVDVSSDYNQVESVIKQAQEKLG--------
                                                         : :* ::*         

A0A3Q3MEY1_BCL2-10      PVDMLVNCAGTSVSGKFEEVEVDRFK------------------------
A0A3Q3MEY1_BCL2-01      EMSRQLYLTSTTAQRRFAEVIDELFR---------------------DGV
A0A3Q3MEY1_BCL2-03      PVDMLVNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAVITTMKER
A0A3Q3MEY1_BCL2-04      PVDMLVNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAVITTMKER
A0A3Q3MEY1_BCL2-05      PVDMLVNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAVITTMKER
A0A3Q3MEY1_BCL2-09      PVDMLVNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAVITTMKER
A0A3Q3MEY1_BCL2-06      PVDMLVNCAGTSVSGKFEEVEVDRFK------------------------
A0A3Q3MEY1_BCL2-08      PVDMLVNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAVITTMKER
A0A3Q3MEY1_BCL2-02      PVDMLVNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAVITTMKER
A0A3Q3MEY1_BCL2-07      PVDMLVNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAVITTMKER
                         :.  :  :.*:.. .* **  : *.                        

A0A3Q3MEY1_BCL2-10      --------------------------------------------------
A0A3Q3MEY1_BCL2-01      NWGRIIAFFEFGGTVCV---------------------------------
A0A3Q3MEY1_BCL2-03      RMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTV
A0A3Q3MEY1_BCL2-04      RMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTV
A0A3Q3MEY1_BCL2-05      RMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTV
A0A3Q3MEY1_BCL2-09      RMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTV
A0A3Q3MEY1_BCL2-06      ----------------------------------------IKPYNIYVTV
A0A3Q3MEY1_BCL2-08      RMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTV
A0A3Q3MEY1_BCL2-02      RMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTV
A0A3Q3MEY1_BCL2-07      RMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTV
                                                                          

A0A3Q3MEY1_BCL2-10      --------------------------------------------------
A0A3Q3MEY1_BCL2-01      ----------------------ECAAKEEMTSQVDNIAEWMT-EYLNGPL
A0A3Q3MEY1_BCL2-03      AYPPDTDTPGLAEENKTKPLETKLISETSGVCQPEQVAKIVVRDAVQGNF
A0A3Q3MEY1_BCL2-04      AYPPDTDTPGLAEENKTKPLETKLISETSGVCQPEQVAKIVVRDAVQGNF
A0A3Q3MEY1_BCL2-05      AYPPDTDTPGLAEENKTKPLETKLISETSGVCQPEQVAKIVVRDAVQGNF
A0A3Q3MEY1_BCL2-09      AYPPDTDTPGLAEENKTKPLETKLISETSGVCQPEQVAKIVVRDAI----
A0A3Q3MEY1_BCL2-06      AYPPDTDTPGLAEENKTKPLETKLISETSGVCQPEQVAKIVVRDAVQGNF
A0A3Q3MEY1_BCL2-08      AYPPDTDTPGLAEENKTKPLETKLISETSGVCQPEQVAKIVVRDAVQGNF
A0A3Q3MEY1_BCL2-02      AYPPDTDTPGLAEENKTKPLETKLISETSGVCQPEQVAKIVVRDAVQGNF
A0A3Q3MEY1_BCL2-07      AYPPDTDTPGLAEENKTKPLETKLISETSGVCQPEQVAKIVVRDAVQGNF
                                                                          

A0A3Q3MEY1_BCL2-10      ------------------------------IITMGLF-------------
A0A3Q3MEY1_BCL2-01      NSWIQDNG--------------------GWDAFVEMYDRQRESVFSCSWP
A0A3Q3MEY1_BCL2-03      NSSVGPDGYMLSALTCGMSPVTSITEALQQIITMGLF-------------
A0A3Q3MEY1_BCL2-04      NSSVGPDGYMLSALTCGMSPVTSITEALQQIITMGLF-------------
A0A3Q3MEY1_BCL2-05      NSSVGPDGYMLSALTCGMSPVTSITEALQQIITMGLF-------------
A0A3Q3MEY1_BCL2-09      -------------------------------ITMGLF-------------
A0A3Q3MEY1_BCL2-06      NSSVGPDGYMLSALTCGMSPVTSITEALQQIITMGLF-------------
A0A3Q3MEY1_BCL2-08      NSSVGPDGYMLSALTCGMSPVTSITEALQQIITMGLF-------------
A0A3Q3MEY1_BCL2-02      NSSVGPDGYMLSALTCGMSPVTSITEALQQDAFVEMYDRQRESVFSCSWP
A0A3Q3MEY1_BCL2-07      NSSVGPDGYMLSALTCGMSPVTSITEALQQIITMGLF-------------
                                                         : ::             

A0A3Q3MEY1_BCL2-10      ---RTIALFYLGSFDSIVRRCMIQREQSKSADKRE
A0A3Q3MEY1_BCL2-01      SIKTVFGLAALGAASITIGAYLTQK----------
A0A3Q3MEY1_BCL2-03      ---RTIALFYLGSFDSIVRRCMIQREQSKSADKRE
A0A3Q3MEY1_BCL2-04      ---RTIALFYLGSFDSIVRRCMIQREQSKSADKRE
A0A3Q3MEY1_BCL2-05      ---RTIALFYLGSFDSIVRRCMIQREQSKSADKRE
A0A3Q3MEY1_BCL2-09      ---RTIALFYLGSFDSIVRRCMIQREQSKSADKRE
A0A3Q3MEY1_BCL2-06      ---RTIALFYLGSFDSIVRRCMIQREQSKSADKRE
A0A3Q3MEY1_BCL2-08      ---RTIALFYLGSFDSIVRRCMIQREHDTALP---
A0A3Q3MEY1_BCL2-02      SIKTVFGLAALGAASITIGAYLTQK----------
A0A3Q3MEY1_BCL2-07      ---RTIALFYLGSFDSIVRRCMIQREHDTALP---
                            .:.*  **: .  :   : *.          

© 1998-2022Legal notice