Dataset for protein Bcl-2 of organism Mastacembelus armatus

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|A0A3Q3MEY1_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Mastacembelus armatus GN=BCL-2 (length=338 residues).
MLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECYRQGAFITLVARDETKLLQAKKEVEKFA
INDKQVVLCISVDVSSDYNQVESVIKQAQEKLGPVDMLVNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAVITTM
KERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISE
TSGVCQPEQVAKIVVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEALQQDAFVEMYDRQRESVFSCSWPSIKTVFG
LAALGAASITIGAYLTQK
>gnl|bcl2dbpro|A0A3Q3MEY1_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Mastacembelus armatus GN=BCL-2 (length=228 residues).
MANECNRNIVEKYICHKLSKRGYVWGFHNVQDEDAANNGSVVAPPPTVVRRCRDASTGPDSESIPQLCRGLPQSDPQAAI
HRVLREAGDELERLYQPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECAAKEEMTSQVDN
IAEWMTEYLNGPLNSWIQDNGGWDAFVEMYDRQRESVFSCSWPSIKTVFGLAALGAASITIGAYLTQK
>gnl|bcl2dbpro|A0A3Q3MEY1_BCL2-03 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Mastacembelus armatus GN=BCL-2 (length=359 residues).
MSSEESLSSTITDWLFINSWWLLLPFIMLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECY
RQGAFITLVARDETKLLQAKKEVEKFAINDKQVVLCISVDVSSDYNQVESVIKQAQEKLGPVDMLVNCAGTSVSGKFEEV
EVDRFKKLMEVNYLGSVYPTRAVITTMKERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTV
AYPPDTDTPGLAEENKTKPLETKLISETSGVCQPEQVAKIVVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEALQQ
IITMGLFRTIALFYLGSFDSIVRRCMIQREQSKSADKRE
>gnl|bcl2dbpro|A0A3Q3MEY1_BCL2-04 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Mastacembelus armatus GN=BCL-2 (length=358 residues).
MSSEESLSSTITDWLFINSWWLLLPFIMLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECY
RQGAFITLVARDEPMPFNLRFHKTVYNFLIQVVLCISVDVSSDYNQVESVIKQAQEKLGPVDMLVNCAGTSVSGKFEEVE
VDRFKKLMEVNYLGSVYPTRAVITTMKERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVA
YPPDTDTPGLAEENKTKPLETKLISETSGVCQPEQVAKIVVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEALQQI
ITMGLFRTIALFYLGSFDSIVRRCMIQREQSKSADKRE
>gnl|bcl2dbpro|A0A3Q3MEY1_BCL2-05 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Mastacembelus armatus GN=BCL-2 (length=352 residues).
MSSEESLSSTITDWLFINSWWLLLPFIMLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECY
RQGAFITLVARDETKLLQAKKEVEKFAINDKQVWVYLSRSDFFAVVQAQEKLGPVDMLVNCAGTSVSGKFEEVEVDRFKK
LMEVNYLGSVYPTRAVITTMKERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVAYPPDTD
TPGLAEENKTKPLETKLISETSGVCQPEQVAKIVVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEALQQIITMGLF
RTIALFYLGSFDSIVRRCMIQREQSKSADKRE
>gnl|bcl2dbpro|A0A3Q3MEY1_BCL2-06 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Mastacembelus armatus GN=BCL-2 (length=268 residues).
MLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECYRQGAFITLVARDETKLLQAKKEVEKFA
INDKQVVLCISVDVSSDYNQVESVIKQAQEKLGPVDMLVNCAGTSVSGKFEEVEVDRFKIKPYNIYVTVAYPPDTDTPGL
AEENKTKPLETKLISETSGVCQPEQVAKIVVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEALQQIITMGLFRTIA
LFYLGSFDSIVRRCMIQREQSKSADKRE
>gnl|bcl2dbpro|A0A3Q3MEY1_BCL2-07 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Mastacembelus armatus GN=BCL-2 (length=329 residues).
MLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECYRQGAFITLVARDETKLLQAKKEVEKFA
INDKQVVLCISVDVSSDYNQVESVIKQAQEKLGPVDMLVNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAVITTM
KERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISE
TSGVCQPEQVAKIVVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEALQQIITMGLFRTIALFYLGSFDSIVRRCMI
QREHDTALP
>gnl|bcl2dbpro|A0A3Q3MEY1_BCL2-08 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Mastacembelus armatus GN=BCL-2 (length=311 residues).
THLLDLWVYDLLTLLNFQVTGGSSGIGKCIAIECYRQGAFITLVARDETKLLQAKKEVEKFAINDKQVVLCISVDVSSDY
NQVESVIKQAQEKLGPVDMLVNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAVITTMKERRMGRIMFVSSQAGQI
GLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETSGVCQPEQVAKIVVRDA
VQGNFNSSVGPDGYMLSALTCGMSPVTSITEALQQIITMGLFRTIALFYLGSFDSIVRRCMIQREHDTALP
>gnl|bcl2dbpro|A0A3Q3MEY1_BCL2-09 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Mastacembelus armatus GN=BCL-2 (length=297 residues).
MLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECYRQGAFITLVARDETKLLQAKKEVEKFA
INDKQVVLCISVDVSSDYNQVESVIKQAQEKLGPVDMLVNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAVITTM
KERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISE
TSGVCQPEQVAKIVVRDAIITMGLFRTIALFYLGSFDSIVRRCMIQREQSKSADKRE
>gnl|bcl2dbpro|A0A3Q3MEY1_BCL2-10 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Mastacembelus armatus GN=BCL-2 (length=174 residues).
MSSEESLSSTITDWLFINSWWLLLPFIMLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECY
RQGAFITLVARDEPGCLYSQVKNAQEKLGPVDMLVNCAGTSVSGKFEEVEVDRFKIITMGLFRTIALFYLGSFDSIVRRC
MIQREQSKSADKRE
© 1998-2022Legal notice