Dataset for protein BCL-2-like of organism Marmota marmota marmota

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:            :  .:: :                                             ..*  .  .     
madcgrt--rnrelvmdylsyklsqpg-------------------------------------rgssPrvtsaa--nvl
insllqrgyftlmiltkfiqhvarvrqyrwsqfsreegnvvqaspraesgpgpssstsgxxsrhttep psspkvlqprs
 ehaefe  dih  aq   h c qek  e      daedrga peg apee ifnaqp nppaaqp nppge ghala
           a       e                                                 mk  ag   

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  .                         .            .      :   .     :   :.***:* :. *.*.:  
ssv--------------------srryrqqfkpytsqlrltpgtavrtfaqvveelfrdn--vnWGRiVafftFgGvlcv
rpappvvpmvavkqtmrqagdnfqkevqrnyhemsdnyhvvsfntrhrmftqamavlsegqims   v tlvf a tmvl
ld  d  hl     al e   d eg lekdledllalfdgh edrhglienm d kef egal      mi e   a lk
                     aa    a a ff e     a  ae            d            a      e

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          . . .          :   :  .   *:  :***:                                *  
esvrremsplvdsias--------wmteylnrhlrtWiqdnGGWdtf--f-----p---w---l------------aClt
rlpqktikvhtrqqvllsyqrlvdlvctqivnrhhe lrqq   en-vg-yrtsv-pty-rtw-vvttqlslalvgs im
kklnerhg a cnd eidc     flaaf mgnaga  eah    g lelvkpplrlsgdlsl sqkgm       i el
  idd  a    d  a               d  d          a cd fgkfe klf fnf glifl          i

       250 
....:....|.
           
l----------
-tlylyyykrf
asilkqhk   
 gafigfc   
© 1998-2023Legal notice