Dataset for protein BCL-2-like of organism Marmota marmota marmota

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             :  .:: :                                       .                   
------ssqdnrelvvdflsyklsqkgy-------------------eseagppsapngnp-------------------
mmmtpamapstlailmkyvghvarvpqtswsqfsdveenrteapegt------gegisstsswhladspavngatghsss
 iaadrttyrihm aa  iq c qer rr     re  davqvgarsvcgvetsnstaad gxxqgartspsrppaanrg
 ahsglrqrf a   t   h        e           gd   aapgaepg gpfpkq  r p    m p  a  aa 
  encglgg      q   e                                   i                        
     cefe                                                                       

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
              .      .      .            .      :              .***:* :. *...:  
-----------vkqalreagdefetryrrafsdltsqlhvtpgtayqrfeqvvdelfrdg--vnWGRiVaffvFggalcv
ldarevipmaa-hlvm-avlrsvslefqqtykpyaanyrlvsfstqrtmttqsnavlqgnqips   l tlvs aavmva
pvlsp v vv l-kt-qqlafnaqr vekqlhemsdlfdih enrvhsianmae keseegam    v mi t   t ll
   pd p      e   n   d ak l  n e fl e  g  ad rgl f   m   f d  l         f      k
                        g    d a  f          he                         e      e
                        a                    a                          a       

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             :           :   :  .   *:   ***                                    
e--------svdkemevlvsriaswmatylndhletWiqsnGGWdtfvelygnna--e-rr--e-------twlltgvtv
rlpretigphtnsqvqpsygqvqelvvaqietrhap lhes   ae--af--dg-pe-s-klr-rfwasvrrvftgamal
kklqdrha airrdasldc-----fltef vrnard  rdq   en t--vr--vlataw-gqygnnwlsl--------s
            d  ki  qnlvl  c   mn  he  eqh    g cg fktslalsg lpl d s    nt vvtgqi
               a   d   d       g  ga   a     a  d   ppe k f            kl gslfm 
                   c              d                 kf                  f  qial 

       250    
....:....|....
              
galvtlgayfs-k-
agvilv-sl-as-f
clml--l-fy-rr 
 ecasifk-lyk  
 c     iq gh  
          c   
© 1998-2022Legal notice