Dataset for protein BCL-2-like of organism Marmota marmota marmota

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A8C5YJP3_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Marmota marmota marmota GN=BCL2A1 (length=175 residues).
MNDCEFRFIHMLAQDYLQHVLQVPQRGSSPNKTSKVLQNVAFSVQKEVEKNLKPYLDNFDVVSADTARTIFNQVMEKEFE
DGIMNWGRIVTIFAFGGVLVKKLLRERIAPAVDSDVEISYFVAEFIMNNAGEWIRQNGGWENGFVKKFEPKSGWLTFLGV
TGQICEMLSLLKQYY
>gnl|bcl2dbpro|A0A8C5YLY6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Marmota marmota marmota GN=BCL2L1 (length=201 residues).
IESCGRTGRNLELVMDFLSYKLSQKGYRWSQFSREEENRVQAPERAESEEGPSNATSGNPSRHQGDSPMVSGAAGHNRSL
DAPDVVPMVAVKQAMREAGDNFEGRYRQAFHDLTAELRLTPETAHHTFEQVVDELFRDEVSWGRIVAFFFFGGALCLESI
DKEMKVLVCQIASWMTTYLNDHLDTWIQDHGGWDTFLACLI
>gnl|bcl2dbpro|A0A8C5YTS1_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Marmota marmota marmota GN=BCL-2 (length=228 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAASPGAAPGPGIFSSQPGXXPAARTSPPRPPAAAAGPVLSPVPP
VVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVD
NIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSVRPLYDFSWLSLKTLLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A8C6ACA1_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Marmota marmota marmota GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEVETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A8C6ACA1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Marmota marmota marmota GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEVETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A8C6EU42_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Marmota marmota marmota GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A8C6EU42_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Marmota marmota marmota GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A8C6EVC2_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Marmota marmota marmota GN=BCL2L10 (length=183 residues).
MADLLQERTAELLTDYLEYCAREPGTPEPPPSTPEAALLRSAAARLQQQYEPFFSLYRGHPGNRVELMAQMAEAVLSDNQ
ALNWGRVVMLVTFAGTLLERKPQDTHGPHTRDQAALDCQRLVDLLCAQLVGRHRAWLEAQGGWDGFCDFFRTPLPLTFWR
NLLVQIFMSCLLATIFIYFCKRF
© 1998-2022Legal notice