Dataset for protein BCL-2-like of organism Marmota marmota marmota

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5YJP3_BCL2A1-      MNDCEFR--FIHMLAQDYLQHVLQVPQ-----------------------
A0A8C6EVC2_BCL2L10      MADLLQE--RTAELLTDYLEYCAREPG-----------------------
A0A8C5YLY6_BCL2L1-      IESCGRTG-RNLELVMDFLSYKLSQKGYRWSQFSREEENRVQAPERAESE
A0A8C5YTS1_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-----DAGDVGAASPGAAPG
                        :            :  .:: :                             

A0A8C5YJP3_BCL2A1-      --------------RGSSPNKTSKVLQNVAFSV-----------------
A0A8C6EVC2_BCL2L10      --------------TPEPPPSTPEA--ALLRSA-----------------
A0A8C5YLY6_BCL2L1-      EGPSNATSGNPSRHQGDSPMVSGAAGHNRSLDAPDVVPMVAVKQAMREAG
A0A8C5YTS1_BCL2-01      PGIFSSQPGXXPAARTSPPRPPAAAAGPVLSPVPPVVHL-----TLRQAG
                                        ..*  .  .       .                 

A0A8C5YJP3_BCL2A1-      ---QKEVEKNLKPYLDNFDVVSADTARTIFNQVMEKEFEDGIMNWGRIVT
A0A8C6EVC2_BCL2L10      ---AARLQQQYEPFFSLYRGHPGNRVELMAQMAEAVLSDNQALNWGRVVM
A0A8C5YLY6_BCL2L1-      DNFEGRYRQAFHDLTAELRLTPETAHHTFEQVVDELFRDE--VSWGRIVA
A0A8C5YTS1_BCL2-01      DDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDG--VNWGRIVA
                                .            .      :   .     :   :.***:* 

A0A8C5YJP3_BCL2A1-      IFAFGGVLVKKLLRERIAPAVDSDVEISY-----FVAEFIMNNAGEWIRQ
A0A8C6EVC2_BCL2L10      LVTFAGTLLERKPQDTHGPHTRDQAALDCQRLVDLLCAQLVGRHRAWLEA
A0A8C5YLY6_BCL2L1-      FFFFGGALCLESIDKEMKVLVCQIAS--------WMTTYLNDHLDTWIQD
A0A8C5YTS1_BCL2-01      FFEFGGVMCVESVNREMSPLVDNIAL--------WMTEYLNRHLHTWIQD
                        :. *.*.:            . . .          :   :  .   *:  

A0A8C5YJP3_BCL2A1-      NGGWEN--GFVKKFEPKSGWLTFLGVTGQ-------ICEMLSLLKQYY--
A0A8C6EVC2_BCL2L10      QGGWDGFCDFFRTPLPLTFWRNLLVQIFM-------SCLLATIFIYFCKR
A0A8C5YLY6_BCL2L1-      HGGWDTFL----------------------------ACLI----------
A0A8C5YTS1_BCL2-01      NGGWDAFVELYGPSVRPLYDFSWLSLKTLLSLALVGACITLGAYLGHK--
                        :***:                                *            

A0A8C5YJP3_BCL2A1-      -
A0A8C6EVC2_BCL2L10      F
A0A8C5YLY6_BCL2L1-      -
A0A8C5YTS1_BCL2-01      -
                         

© 1998-2023Legal notice