Dataset for protein BCL-2-like of organism Marmota marmota marmota

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5YJP3_BCL2A1-      --MNDCEFRFIHMLAQDYLQHVLQVPQR----------------------
A0A8C6EVC2_BCL2L10      --MADLLQERTAELLTDYLEYCAREPGT----------------------
A0A8C5YTS1_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEW--------DAGDVGAASPGA
A0A8C6ACA1_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESE
A0A8C6ACA1_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESE
A0A8C6EU42_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGY-------------------VCG
A0A8C6EU42_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGY-------------------VCG
A0A8C5YLY6_BCL2L1-      -IESCGRTGRNLELVMDFLSYKLSQKGYRWSQFSREEENRVQAPERAESE
                                     :  .:: :                             

A0A8C5YJP3_BCL2A1-      ---GSSPNKTS--------------------------------KVLQNVA
A0A8C6EVC2_BCL2L10      ---PEPPPSTP--------------------------------EA--ALL
A0A8C5YTS1_BCL2-01      APGPGIFSSQPGXXPAARTSPPRPPAAAAGPVLSPVPPV--VHLTLRQAG
A0A8C6ACA1_BCL2L1-      VETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAG
A0A8C6ACA1_BCL2L1-      VETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAG
A0A8C6EU42_BCL2L2-      AGPGEGPAADP------------------------------LHQAMRAAG
A0A8C6EU42_BCL2L2-      AGPGEGPAADP------------------------------LHQAMRAAG
A0A8C5YLY6_BCL2L1-      EGPSNATSGNPSRHQGDSPMVSGAAGHNRSLDAPDVVPMVAVKQAMREAG
                                  .                                 .     

A0A8C5YJP3_BCL2A1-      FSVQKEVEKNLKPYLDNFDVVSADTARTIFNQVMEKEFEDGIMNWGRIVT
A0A8C6EVC2_BCL2L10      RSAAARLQQQYEPFFSLYRGHPGNRVELMAQMAEAVLSDNQALNWGRVVM
A0A8C5YTS1_BCL2-01      DDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDG--VNWGRIVA
A0A8C6ACA1_BCL2L1-      DEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDG--VNWGRIVA
A0A8C6ACA1_BCL2L1-      DEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDG--VNWGRIVA
A0A8C6EU42_BCL2L2-      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGG--PNWGRLVA
A0A8C6EU42_BCL2L2-      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGG--PNWGRLVA
A0A8C5YLY6_BCL2L1-      DNFEGRYRQAFHDLTAELRLTPETAHHTFEQVVDELFRDE--VSWGRIVA
                         .      .            .      :              .***:* 

A0A8C5YJP3_BCL2A1-      IFAFGGVLVKKLLRERIAPAVDSDVEISY-----FVAEFIMNNAGEWIRQ
A0A8C6EVC2_BCL2L10      LVTFAGTLLERKPQDTHGPHTRDQAALDCQRLVDLLCAQLVGRHRAWLEA
A0A8C5YTS1_BCL2-01      FFEFGGVMCVE--------SVNREMSPLVDNIALWMTEYLNRHLHTWIQD
A0A8C6ACA1_BCL2L1-      FFSFGGALCVE--------SVDKEMQVLVSRIASWMATYLNDHLEPWIQE
A0A8C6ACA1_BCL2L1-      FFSFGGALCVE--------SVDKEMQVLVSRIASWMATYLNDHLEPWIQE
A0A8C6EU42_BCL2L2-      FFVFGAALCAE--------SVNKEMEPLVGQVQEWMVAYLETRLADWIHS
A0A8C6EU42_BCL2L2-      FFVFGAALCAE--------SVNKEMEPLVGQVQEWMVAYLETRLADWIHS
A0A8C5YLY6_BCL2L1-      FFFFGGALCLE--------SIDKEMKVLVCQIASWMTTYLNDHLDTWIQD
                        :. *...:               :           :   :  .   *:  

A0A8C5YJP3_BCL2A1-      NGGWEN--GFVKKFEPKSGWL----------TFLGVTGQICEMLSLLKQY
A0A8C6EVC2_BCL2L10      QGGWDGFCDFFRTPLPLTFWR----------NLLVQIFMSCLLATIFIYF
A0A8C5YTS1_BCL2-01      NGGWDAFVELYGPSV-----RPLYDFSWLSLKTLLSLALVGACITLGAYL
A0A8C6ACA1_BCL2L1-      NGGWDTFVELYGNNAAAESRKGQERFN----RWFLTGMTVAGVVLLGSLF
A0A8C6ACA1_BCL2L1-      NGGWDTFVELYGNNAAAESRKGQERFN----RWFLTGMTVAGVVLLGSLF
A0A8C6EU42_BCL2L2-      SGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFF
A0A8C6EU42_BCL2L2-      SGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFF
A0A8C5YLY6_BCL2L1-      HGGWDTF--------------------------------LACLI------
                         ***                                              

A0A8C5YJP3_BCL2A1-      Y---
A0A8C6EVC2_BCL2L10      CKRF
A0A8C5YTS1_BCL2-01      GHK-
A0A8C6ACA1_BCL2L1-      SRK-
A0A8C6ACA1_BCL2L1-      SRK-
A0A8C6EU42_BCL2L2-      ASK-
A0A8C6EU42_BCL2L2-      ASK-
A0A8C5YLY6_BCL2L1-      ----
                            

© 1998-2022Legal notice