Dataset for protein BCL-2-like of organism Macaca fascicularis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------ykl-qkg------y--gag-g-g---------------
mpllilspyihasvsslpliaarmatpasapdtralvadfvg---r---yiglnl-vc---p-e-paadpppggrllate
                      mahagrmsqsn ei vkylmfg krnavswsqfscgeenltaasggat          
                            tgy      m  is   s r  e     dv  dr dvge te          
                                         h                   a    s             
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
keasarreigggeagtviggsagaspraaltpdarrvarpppigaevpdvtasparllffaptrragpleemeapaadai
                          p                                       a             
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mspeeeldgyepeplgkrpavlpllelvgesgnspstdmstpstpppnpsehdelyrqslelvdsplvnqatgakdtlpm
                                    segel gaingaeewehpaastvpviisryaregyrlhssskda
                                    gaapa  vfssq ghp     rdesmttcefgyprpqrqeyvqy
                                           icgag   g         armwtrttllepqtlvrrw
                                                              mgekmpkikaeknarelq
                                                               e   eg     g n kg
                                                                   ad     a a a 
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                    .                                                           
----p----lhqalraagdefetrfrrtfsdlaaqlhvtp-----gsaqqrftqvsdelfqdg-p-nwGrivaffv--Fg
rrsi-tsrval-tmsrvlqkvqrnheta-qgmls---i--nvasietdrksls--------g-pgvdy--l-tlisah--
gevgampakkqevtmsieegma--y---v-----kcd-kn     dd-vtlyermmehvps-s vt-- a-a---e   h
vlqs sagsgpsk-ge yaslsls-qke ekntrpvldnv     a-vysi-vt vvkelrrd npt   t eil-   e
pylv qtpt--p-p t a r rflv sf aeyvkg  ly      -vr-e-vnl ana  e   iir   v seva   a
mpp  vmdpvgl i q   d  q    d  awsg           qn n-  a       c   -r         t    
dnm  p  nhag                    rc           f   g  -                           
 a   a  e                                           r                           
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
aalc------------------aesvnkemeplvgqvqewmvaylet--------------------rladwihssggw-
g---ereplvtawwkkrgfqprv---tilqqkcisrlaa--t----dkesvrtslaldeslfrgrqihkrpklqknr-il
-fva                  -hlk--nikvfsepi--si-tvfn-                    t-e-dvver-e- 
 cgs                  knrqdr-cds-lrh-kgfaade vr                    -vit-r--qp   
 vml                  lke egd---d---pvrllysr sg                    ki-sgftt-k   
 t                           vsr cqnfclccwi  a                     sth  -dnya   
                             ha  adg     se                              rl     
                                  a                                       d     
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
sqiteaemadevicseilsdcdsapsspdleeleaikarvremeeeaeklkelqnevekqmnmspppgnagpvimsieek
                      gfveffhv d           f agqsvrgqgsp t rvsll               r
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------stfvglyg-natae---------------tilltgfsgvpagvaylef--------------------------
meadardiy-en--yg----ereahfhgcgsvnrvrwfcdk-athgkvfvlgslsdkksvrtslaldeslfrgrqikvip
isranq---d--vdn-raraslrgqerfnfgirnrllafs-vms-agwltfii-fsrevesvttkksyy           
      hyttagfpranyg wtkqynswr nwlslk---arm-ar-rlrlvrarlgslrgmplswyqvc           
      alrlre imsmpl ritnrggsg eaig stvy-lln-ls-kishtgywthrlailahl kpa           
       g chh rspfle fw lnpl e   a  -r vqaavvknnctn m-vtf ik  a     m            
       e   f  p     a       d      nv sk  trillam   ys e hh                     
       a      d                     g i   lpc h h   pm a  c                     
                                          ela   a    g                          

       570       580       590       600       610       620
....:....|....:....|....:....|....:....|....:....|....:....|
                                                            
------------------------------------------------------------
krtnrpgisttdrgfpraryrarttnynssrsrfysgfnsrprgrvyrsgaratswyspy
                                      ra        gr      fl  
                                                            
                                                            
                                                            
                                                            
                                                            
                                                            
© 1998-2022Legal notice