Dataset for protein BCL-2-like of organism Macaca fascicularis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------------------------------------g---
mmatpasapdtrelvadfvmyklsqkgyswsqgsvvemtrtlaprtnrvstqylmetpsatngnpgwkyvplppyl-yvl
 ahagrtsysn ai vkylgfg rrnave dafddgaenppfrlkrgillslsgycphrmidcefsyittlsrdvnqptg
      mgq      m  is   k r           aadmegeepeafigepehtggpglsrgsmghrrgaqaqkalna
                   h                    ga  a    gadn g caa agad varlsdggtpieagt
                                                                   a p   rla ta 
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--pgagpgegpt-arplhqalraagdeferryrrafsdmatqlh-tpgtayqsfeqvvnelfrdgv--nwgrivaffsfg
yv--p--r-s--gs-vv--r-----k-vstnfeptvpeltsv--isidssrtr----me------pgi------t-----
qsss-ds-p-sv -t--qk-mlsvq-glnlswkiplgsvnvhigg-afarvplvttm--kvlsgs- tt   l -lvv e
higqlslpavkp mdapkgvafqte daqk rftggdnagaa pvknendqk-lnr sdhe q  i p    v siia a
pccr maasaia pasaglt  e     ha l scyrgy--- dl   d pg  al ava  e              t  
ketk  t l as lpk le   r        h  d q  srk         e  s                      e  
adaa  g    g     aa                 a  l                                        
 a                                                                              

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
. :                                                                             
galcvesvrk------------------emqplvs---riaawmatylndhledwiqsnggwdtfv-----------ely
aivtkklrdvtawwkkrgfqprlkeqegrrevdigtyk---e---e---trvrpvtresarllg-aptrrarpleem-a-
 vmipdalnq                  aiaspcd   qvs-fvv-fimrntpe lhqqr  efg-ika vgem   h-p
 t lareptr                  nvprc q   elqysltav enekgt  akp   gnet     a     aff
 f aeh kli                  dqs   e   p vllissr vathaa  vd    al f             e
                                      n      d  agq h    a     k c              
                                                               e                
                                                               a                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
gnnaaaesrk-qe-f-------rwlltg-mtv----------------------------------agvvllgslfsrk-
----------g--r-npeplwknpfvmpllelvgesgnspstdgslpstpppaeeeedelyrcgsvgsltiisyylr--a
aadmlmspererdgyegswgsvktvil-a-lcmeadar iyvgnv  dygat   l ahfhg    qagetvkrmw-eqp
rvsfiengwellpnmsfpsagmtvapvtivak                                  evcahkcakitsll
kspepqgfv kvml d n  nlglmessgkva                                  nrasgfaqfclhh 
hpkd laei   kk   k   h h  qlfgi                                   lm ia  k agg  
 lg    a             a f  af e                                     l     d  a   
 de                        a a                                                  

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
tgakdtkpmgrsgatsrkaletlrrvgdgvqrnhetafqgwvrkvdiknedivkstsrvmvsvtsrgvtrwryrvtttsy
k fayiefsdkesvrtsl  d              sl r rqigl      dp rln pgihtpdd prnagriarlinf
                                        mlc                   lfc  fp           
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
nssvsrhystinsrscirvyrrsiwsvlvrtkrswyvpyrgwdgfveffhvedleggirnvllafagvagvsnklaylir
gafrakflkgf qqprgeplcgrctd      td lskq                               igagi l   
            hek aagfaecara         f                                            
                                                                                
                                                                                
                                                                                
                                                                                
© 1998-2020Legal notice