Dataset for protein BCL-2-like of organism Macaca fascicularis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------------------w--l-lpav-g---
mmhtprtsydnrelvvdfvsyklsqkgyswsqgsvvemtrtlaprtnrvstqylmetpsatngnpg-ky-p----l-yvl
 aaagasgqst ai mkylh   r r  e dafddgaenppfrlkrgimlspssycptrmldcefvyitvlsrpynqptg
      map      a  ig                 aadmegeepealiglpghtghpgivadssmhrtkrqdqkalna
                                        ga  a   fgaenegpdga asrg mgflrgantpieagt
                                                 a da a ca   g    aygsdqkrla ta 
                                                                   rkprggg      
                                                                   a            
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--pgagpgegpt-arplhqalraagdeferryrrafsdmatqlh-tpgtayqsfeqvvnelfrdgv--nwgrivaffsfg
yv--p--r-s--gs-vv--r-----k-vstnfeptvpeltsv--isidssrtr----me------pgi------t-----
qsss-ds-p-sv -t--qk-mlsvq-glnlswkiplgsvnvhigg-afarvplvttm--kvlsgs- tt   l -lvv e
higqlslpavkp mdapkgvafqte daqk rftggdnagaa pvknendqk-lnr sdhe q  i p    v siia a
pccr maasaia pasaglt  e     ha l scyrgy--- dl   d pg  al ava  e              t  
ketk  t l as lpk le   r        h  d q  srk         e  s                      e  
adaa  g    g     aa                 a  l                                        
 a                                                                              
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
. :                                                                             
galcvesvrk------------------emqplvs---riaawmatylndhledwiqsnggwdt-fvelygnnalee---
aivtkklrdvtawwkkrgfqprlkeqegrrevdigtyk---e---e---trvrpvtresarllgg-aptfrvgpaa-mea
 vmipdalnq                  aiaspcd   qvs-fvv-fimrntpe lhqqr  ef e--kr-p----g   
 t lareptr                  nvprc q   elqysltav enekgt  akp   gn  tkf-hasspla   
 f aeh kli                  dqs   e   p vllissr vathaa  vd    al  ci-ae-rmm     
                                      n      d  agq h    a     k   h   spf      
                                                               e   a   dke      
                                                               a        ed      
                                                                        a       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                        .       
------------------------------------------srk------------rwfltg-mtvagvvllgslfsrk
paadaimspeeeldgyepeplgkrpavlpllelvgesgnsps---gqerfnppaeeletltyra---gsleivsyylreq
eklkelqnev kqmnms p gnag vimsie kmeadar iytdrsrpstpgtwlsekdhnhlpvalqlcttiarkkt--
                                          vwgvl lygfs a v-veismfgvg-agisfcafwqyl
                                          ginl  d dan    nlvfqfelscnvaam  l iksh
                                          fg             gam facalalr  g  h  gmc
                                          a                  a     ki  a  d  aha
                                                                              g 
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
ltgakdtkpmgrsgatsrkaletlrrvgdgvqrnhetafqgwvrkvdiknedivkstsrvmvsvtsrgvtrwryrvttts
ak fayiefsdkesvrtsl  d              sl r rqigl      dp rln pgihtpdd prnagriarlin
p                                        mlc                   lfc  fp          
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
ynssvsrhystinsrscirvyrrsiwsvlvrtkrswyvpyrgwdgfveffhvedleggirnvllafagvagvsnklayli
fgafrakflkgf qqprgeplcgrctd      td lskq                               igagi l  
             hek aagfaecara         f                                           
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

 
.
 
-
r
 
 
 
 
 
 
 
© 1998-2020Legal notice