Dataset for protein BCL-2-like of organism Macaca fascicularis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------r-lv-d--gykl-qkg------y--gag-g-g---------------
mpllilspyihasvsslpliaarmatpasapdt-a--a-fv----r---yiglnl-vc---p-e-paadpppggrllate
                      mamadcmsqynyeiavkylmfg krnavswsqfscgeenltaasggat          
                        h grefgsi r  q  is   s r  e     dv  dr dvge te          
                            tgy      m   q                   a    s             
                                         h                                      
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
keasarreigggeagtviggsagaspraaltpdarrvarpppigaevpdvtasparllffaptrragpleemeapaadai
                          p                                       a             
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mspeeeldgyepeplgkrpavlpllelvgesgnspstdmstpstpppnpsehdelyrqslelvssplvnqatgakstlpm
                                    segel gaingaeewehpaastvpviidryareggpshtdskla
                                    gaapa  vfssq ghp     rdesvrqitqpgslrpkservdq
                                           icgag   g         alt  matp aeraaa ag
                                                               g    d           
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------lhqalraagdefetrfrrtfsdlaaqlhvtpgsaqqrftqvsdelfqd--gv-nwGrivaffv--Fgaalc
grsgptsrval-tmkrvl-gvqrnheta-qgm-s---iknetdyksler-mehvysggpnptdy--l-tlisah--gfva
reviavaakvqen--ec-qn-nvay---p---t-kvd--imdivelmsadvv-i-r-s iir-- a-a---e   h----
kvlfsmqpekek-tgp-pl-n-l--wspmvpylrthpps-d--rtk-n-mansepvr  -- t   t eil-   e igs
pyas stkp--lve lrearls-lrqmn aewvgnagly -nre--vat --k-le      r   v seva   a cmi
da   apdmmw r  -ka qgrqek  f  asscg  gv f  -g  -l  ra  -               t     v l
         ea    s   k ln    d   pr                      c                     t  
               q   d            p                                               
                                m                                               

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------aesvnkemeplvg---qvqewmvaylet--------------------rladwihssggw--
ereplvtawwkkrgfqprvklktinqqvcistykriaafiatv-ndkesvrtslaldeslfrgrqihtrpklqknr--ls
                  kh--d--iasdse   plsysvte-ivr                    tkee-rver- i  
                  --rl-qrcdkf-d   hpkg-aydff--                    --i-gfr-qp    
                  lneqrrl----c-   e---l--se sn                    nvgt --q-a    
                      egdvsr aq   -fvrclwir mg                    k -s  tn      
                         h    a   n cl cs-  a                     s h    l      
                                  g                                      d      
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
qiteaemadevicseilsdcdsapsspdleeleaikarvremeeeaeklkelqnevekqmnmspppgnagpvimsieekm
                     gfveffhv d           f agqsvrgqgsp t rvsll               ri
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------et-f----gcgsvrrvtilce-f-g-----ayllf------g-vll----------------
eadarsiyvgnvdygatadel-vhly--naane-r---dr-s-hpkgfrwietsdkesv-v---ldeslfrgrqikvipk
sranqhlrl h       --geaefhpn-g---s-kgq-kvnsvgaslkffirgnmtvartsya                
                  sn tdrgfrra-ianrllafagsarswnkv-tysgmtvrprlretv                
                  gk  tkk epsrylafwtnynslrfnsl iwlvt-lpsalgactsr                
                  ag  ca   spmpiga r rsl d inh as t-sffllglilimf                
                   a       dkfle   v sp    a    g mnqaea ck a a                 
                             e                    h h a                         
                                                                                

       570       580       590       600       610         
....:....|....:....|....:....|....:....|....:....|....:....
                                                           
------------------------------------------g-l---k----------
rtnrpgisttdrgfpraryrarttnynssrsrfysgfnsrpr-r-yrr-aratswyspy
                                     ra   asvfssrlipltkklv 
                                          saykthgg     f   
                                           ykwqgl          
                                           lflkyh          
                                           h egmc          
                                           g  a a          
                                                           
© 1998-2022Legal notice