Dataset for protein BCL-2-like of organism Macaca fascicularis

[Download (right click)] [Edit] [Sequences] [Repertoires]

21 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5V0Q3_BCL2L2-      MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKG-
A0A2K5V0Q3_BCL2L2-      MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKG-
A0A2K5V0Q3_BCL2L2-      MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKG-
A0A2K5V0Q3_BCL2L2-      MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKG-
A0A2K5V0Q3_BCL2L2-      MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKG-
A0A2K5V0Q3_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLRQKG-
A0A2K5W0Y7_MCL1-02      -----------------------------------------MFGLKRNAV
A0A2K5W0Y7_MCL1-03      -----------------------------------------MFGLKRNAV
A0A2K5W0Y7_MCL1-01      -----------------------------------------MFGLKRNAV
I7G687_MCL1-01          -----------------------------------------MFGLKRNAV
A0A2K5TKG9_BCL2L10      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLRQKGY
A0A7N9CNB8_BCL2-01      ----------------------MAHAGRTGYDNREIVMKYIHYKLSQRGY
A0A2K5VPG2_BCL2L1-      ----------------------------MSQSNRELVVDFLSYKLSQKGY
A0A2K5VPG2_BCL2L1-      ----------------------------MSQSNRELVVDFLSYKLSQKGY
Q2PFS6_BCL2L1-01        --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5V0Q3_BCL2L2-      -----YVCGAGPGEGPAADP------------------------------
A0A2K5V0Q3_BCL2L2-      -----YVCGAGPGEGPAADP------------------------------
A0A2K5V0Q3_BCL2L2-      -----YVCGAGPGEGPAADP------------------------------
A0A2K5V0Q3_BCL2L2-      -----YVCGAGPGEGPAADP------------------------------
A0A2K5V0Q3_BCL2L2-      -----YVCGAGPGEGPAADP------------------------------
A0A2K5V0Q3_BCL2L2-      -----YVCGAGPGEGPAADP------------------------------
A0A2K5W0Y7_MCL1-02      IGLNLYCGGAGLGAGSGGAT-PGGRLL-----------------------
A0A2K5W0Y7_MCL1-03      IGLNLYCGGAGLGAGSGGAT-PGGRLLATEKEASARREIGGGEAGTVIGG
A0A2K5W0Y7_MCL1-01      IGLNLYCGGAGLGAGSGGAT-PGGRLLATEKEASARREIGGGEAGTVIGG
I7G687_MCL1-01          IGLNLYCGGAGLGAGSSGATPPGGRLLATEKEASARREIGGGEAGTVIGG
A0A2K5TKG9_BCL2L10      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A7N9CNB8_BCL2-01      EW--------DAGDVGAATP------------------------------
A0A2K5VPG2_BCL2L1-      SWSQFSDVEENRTEAPEGTE------------------------------
A0A2K5VPG2_BCL2L1-      SWSQFSDVEENRTEAPEGTE------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5W0Y7_MCL1-02      --------------------------------------------------
A0A2K5W0Y7_MCL1-03      SAGASPR-ALTPDARRVARPPPIGAEVPDVTASPAR--FFAPTRRAGPLE
A0A2K5W0Y7_MCL1-01      SAGASPR-ALTPDARRVARPPPIGAEVPDVTASPAR--FFAPTRRAGPLE
I7G687_MCL1-01          SAGASPPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRRAAPLE
A0A2K5TKG9_BCL2L10      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A7N9CNB8_BCL2-01      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5W0Y7_MCL1-02      --------------------------------------------------
A0A2K5W0Y7_MCL1-03      EMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGS
A0A2K5W0Y7_MCL1-01      EMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGS
I7G687_MCL1-01          EMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGS
A0A2K5TKG9_BCL2L10      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A7N9CNB8_BCL2-01      ----------------------------------------------GAAP
A0A2K5VPG2_BCL2L1-      ----------------------------------------------SEME
A0A2K5VPG2_BCL2L1-      ----------------------------------------------SEME
Q2PFS6_BCL2L1-01        ------------------------------------------------ME
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5V0Q3_BCL2L2-      -------------------------------------------------L
A0A2K5V0Q3_BCL2L2-      -------------------------------------------------L
A0A2K5V0Q3_BCL2L2-      -------------------------------------------------L
A0A2K5V0Q3_BCL2L2-      -------------------------------------------------L
A0A2K5V0Q3_BCL2L2-      -------------------------------------------------L
A0A2K5V0Q3_BCL2L2-      -------------------------------------------------L
A0A2K5W0Y7_MCL1-02      ------------------------------ATGAKDTKPMGRSGATSRKA
A0A2K5W0Y7_MCL1-03      LPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKA
A0A2K5W0Y7_MCL1-01      LPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKA
I7G687_MCL1-01          LPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKA
A0A2K5TKG9_BCL2L10      -----------------TVESLRGRTMADPLRERTERLLADYLGPSTPEA
A0A2K5V0Q3_BCL2L2-      ---VCGAGPGEG--------------------------------PAADPL
A0A7N9CNB8_BCL2-01      APGIFSSQPGHPHPAASRDPVARTSPLPTPAAPAAAAVAGPALSPVPPVV
A0A2K5VPG2_BCL2L1-      TPSAINGNPSWH---------LVDSPAVNGATGHSSSLDAREVIPMAAVK
A0A2K5VPG2_BCL2L1-      TPSAINGNPSWH---------LVDSPAVNGATGHSSSLDAREVIPMAAVK
Q2PFS6_BCL2L1-01        TPSAINGNPSWH---------LVDSPAVNGATGHSSSLDAREVIPMAAVK
A0A2K5TMD1_BCL2A1-      ---------------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSG
A0A2K5TMD1_BCL2A1-      ---------------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSG
I7GKS6_BCL2L1-01        -----------------------MWKRTGLRPQKGLNRRWRPPVPSMATH
A0A2K5V0Q3_BCL2L2-      ----------------------MEEEAEKLKELQNEVEKQMNMSPPPGNA
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5V0Q3_BCL2L2-      HQAMRAAGDEFETRFRRTFSDLAAQLHVTP-----GSAQQRFTQVSDELF
A0A2K5V0Q3_BCL2L2-      HQAMRAAGDEFETRFRRTFSDLAAQLHVTP-----GSAQQRFTQVSDELF
A0A2K5V0Q3_BCL2L2-      HQAMRAAGDEFETRFRRTFSDLAAQLHVTP-----GSAQQRFTQVSDELF
A0A2K5V0Q3_BCL2L2-      HQAMRAAGDEFETRFRRTFSDLAAQLHVTP-----GSAQQRFTQVSDELF
A0A2K5V0Q3_BCL2L2-      HQAMRAAGDEFETRFRRTFSDLAAQLHVTP-----GSAQQRFTQVSDELF
A0A2K5V0Q3_BCL2L2-      HQAMRAAGDEFETRFRRTFSDLAAQLHVTP-----GSAQQRFTQVSDELF
A0A2K5W0Y7_MCL1-02      LETLRRVGDGVQRNHETAFQGMLRKLDIKN-----EDDVKSLSRVMVHVF
A0A2K5W0Y7_MCL1-03      LETLRRVGDGVQRNHETAFQGWVCGV----------------------LP
A0A2K5W0Y7_MCL1-01      LETLRRVGDGVQRNHETAFQGMLRKLDIKN-----EDDVKSLSRVMVHVF
I7G687_MCL1-01          LETLRRVGDGVQRNHETAFQGMLRKLDIKN-----EDDVKSLSRVMVHVF
A0A2K5TKG9_BCL2L10      A-VLRSAAARLRQLHRSFFSAYRG----YP-----GNRVELVALMAEAVL
A0A2K5V0Q3_BCL2L2-      HQAMRAAGDEFETRFRRTFSDLAAQLHVTP-----GSAQQRFTQVSDELF
A0A7N9CNB8_BCL2-01      HLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-----FTARGRFATVVEELF
A0A2K5VPG2_BCL2L1-      Q-ALREAGDEFELRYRRAFSDLTSQLHITP-----GTAYQSFEQ------
A0A2K5VPG2_BCL2L1-      Q-ALREAGDEFELRYRRAFSDLTSQLHITP-----GTAYQSFEQVVNELF
Q2PFS6_BCL2L1-01        Q-ALREAGDEFELRYRRAFSDLTSQLHITP-----GTAYQSFEQVVNELF
A0A2K5TMD1_BCL2A1-      PSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEF
A0A2K5TMD1_BCL2A1-      PSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEF
I7GKS6_BCL2L1-01        PGTPGTAYQSFE-----------------------QVVNELFR-------
A0A2K5V0Q3_BCL2L2-      GPVIMSIEEKME-----------------------ADARSIYV-------
A0A2K5V0Q3_BCL2L2-      ----MSIEEKME-----------------------ADARSIYV-------
                                  .                                       

A0A2K5V0Q3_BCL2L2-      QGG-P-NWGRLVAFFV--FGAALC------------------AESVNKEM
A0A2K5V0Q3_BCL2L2-      QGG-P-NWGRLVAFFV--FGAALC------------------AESVNKEM
A0A2K5V0Q3_BCL2L2-      QGG-P-NWGRLVAFFV--FGAALC------------------AESVNKEM
A0A2K5V0Q3_BCL2L2-      QGG-P-NWGRLVAFFV--FGAALC------------------AESVNKEM
A0A2K5V0Q3_BCL2L2-      QGG-P-NWGRLVAFFV--FGAALC------------------AESVNKEM
A0A2K5V0Q3_BCL2L2-      QGG-P-NWGRLVAFFV--FGAALC------------------AESVNKEM
A0A2K5W0Y7_MCL1-02      SDG-VTNWGRIVTLIS--FGAFVA------------------KHLKTINQ
A0A2K5W0Y7_MCL1-03      CRG-PRRW-----------------------------------------H
A0A2K5W0Y7_MCL1-01      SDG-VTNWGRIVTLIS--FGAFVA------------------KHLKTINQ
I7G687_MCL1-01          SDG-VTNWGRIVTLIS--FGAFVA------------------KHLKTINQ
A0A2K5TKG9_BCL2L10      SDSPGPTWGRVVSLVT--FAGTLLEREPLVTAWWKKRGFQPRLKEQEGDV
A0A2K5V0Q3_BCL2L2-      QG--GPNWGRLVAFFV--FGAALC------------------AESVNKEM
A0A7N9CNB8_BCL2-01      RD--GVNWGRIVAFFE--FGGVMC------------------VESVNREM
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      RD--GVNWGRIVAFFS--FGGALC------------------VESVDKEM
Q2PFS6_BCL2L1-01        RD--GVNWGRIVAFFS--FGGALC------------------VESVDKEM
A0A2K5TMD1_BCL2A1-      EDG-IINWGRIVTIFA--FEG--------------------------ILI
A0A2K5TMD1_BCL2A1-      EDG-IINWGRIVTIFA--FEG--------------------------ILI
I7GKS6_BCL2L1-01        --D-GVNWGRIVAFFS--FGGALC------------------VESVDKEM
A0A2K5V0Q3_BCL2L2-      --G-NVDYGATAEELEAHFHGCGS------------------VNRVTILC
A0A2K5V0Q3_BCL2L2-      --G-NVDYGATAEELEAHFHGCGS------------------VNRVTILC
                                                                          

A0A2K5V0Q3_BCL2L2-      EPLVGQVQEWMVAYLET--------------------RLADWIHSSGGWL
A0A2K5V0Q3_BCL2L2-      EPLVGQVQEWMVAYLET--------------------RLADWIHSSGGW-
A0A2K5V0Q3_BCL2L2-      EPLVGQVQEWMVAYLET--------------------RLADWIHSSGGWL
A0A2K5V0Q3_BCL2L2-      EPLVGQVQEWMVAYLET--------------------RLADWIHSSGGWL
A0A2K5V0Q3_BCL2L2-      EPLVGQVQEWMVAYLET--------------------RLADWIHSSGGWL
A0A2K5V0Q3_BCL2L2-      EPLVGQVQEWMVAYLET--------------------RLADWIHSSGGWL
A0A2K5W0Y7_MCL1-02      ESCIEPLAESITDVLVR--------------------TKRDWLVKQRGW-
A0A2K5W0Y7_MCL1-03      QKCAAGFCRCCWS--------------------------RSWF-------
A0A2K5W0Y7_MCL1-01      ESCIEPLAESITDVLVR--------------------TKRDWLVKQRGW-
I7G687_MCL1-01          ESCIEPLAESITDVLVR--------------------TKRDWLVKQRGW-
A0A2K5TKG9_BCL2L10      ARDCQRLVALLSSRLAG--------------------STAPGFRLRA---
A0A2K5V0Q3_BCL2L2-      EPLVGQVQEWMVAYLET--------------------RLADWIHSSGGW-
A0A7N9CNB8_BCL2-01      SPLVDNIALWMTEYLNR--------------------HLHTWIQDNGGW-
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      QVLVSRIAAWMATYLND--------------------HLEPWIQENGGW-
Q2PFS6_BCL2L1-01        QVLVSRIAAWMATYLND--------------------HLEPWIQENGGW-
A0A2K5TMD1_BCL2A1-      KKLLRQ-------------------------------RIAPDVDTYKEI-
A0A2K5TMD1_BCL2A1-      KKLLRQ-------------------------------RIAPDVDTYKEI-
I7GKS6_BCL2L1-01        QVLVSRIAAWMATYLND--------------------HLEPWIQENGGW-
A0A2K5V0Q3_BCL2L2-      DKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGI-
A0A2K5V0Q3_BCL2L2-      DKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGI-
                                                                          

A0A2K5V0Q3_BCL2L2-      SQITEAEMADEVICSEILSDCDSAPSSPDLE------------FEAGQSV
A0A2K5V0Q3_BCL2L2-      -------------------------------ELEAIKARVREMEEEAEKL
A0A2K5V0Q3_BCL2L2-      SQITEAEMADEVICSEILSDCDSAPSSPDLEELEAIKARVREMEEEAEKL
A0A2K5V0Q3_BCL2L2-      SQITEAEMADEVICSEILSDCDSAPSSPDLEELEAIKARVREMEEEAEKL
A0A2K5V0Q3_BCL2L2-      SQITEAEMADEVICSEILSDCDSAPSSPDLEELEAIKARVREMEEEAEKL
A0A2K5V0Q3_BCL2L2-      SQITEAEMADEVICSEILSDCDSAPSSPDLEELEAIKARVREMEEEAEKL
A0A2K5W0Y7_MCL1-02      ---------------------DGFVEFFHVEDLE----------------
A0A2K5W0Y7_MCL1-03      --------------------------------------------------
A0A2K5W0Y7_MCL1-01      ---------------------DGFVEFFHVEDLE----------------
I7G687_MCL1-01          ---------------------DGFVEFFHVEDLE----------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A7N9CNB8_BCL2-01      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5V0Q3_BCL2L2-      RGQGSPVTKRVSLL---------------RISRANQHLRLGH--------
A0A2K5V0Q3_BCL2L2-      KELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAE
A0A2K5V0Q3_BCL2L2-      KELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAE
A0A2K5V0Q3_BCL2L2-      KELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAE
A0A2K5V0Q3_BCL2L2-      KELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAE
A0A2K5V0Q3_BCL2L2-      KELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAE
A0A2K5W0Y7_MCL1-02      --------------------------------------------------
A0A2K5W0Y7_MCL1-03      --------------------------------------------------
A0A2K5W0Y7_MCL1-01      --------------------------------------------------
I7G687_MCL1-01          --------------------------------------------------
A0A2K5TKG9_BCL2L10      ------------------------------------DGFCHFFRSPFPLA
A0A2K5V0Q3_BCL2L2-      ------------------------------------AEFTALYGDGALEE
A0A7N9CNB8_BCL2-01      ------------------------------------DAFVELYGPSM---
A0A2K5VPG2_BCL2L1-      ------------------------------------DTFVELYGNNAAAE
A0A2K5VPG2_BCL2L1-      ------------------------------------DTFVELYGNNAAAE
Q2PFS6_BCL2L1-01        ------------------------------------DTFVELYGNNAAAE
A0A2K5TMD1_BCL2A1-      ------------------------------------SYFVAEFIMNNTGE
A0A2K5TMD1_BCL2A1-      ------------------------------------SYFVAEFIMNNTGE
I7GKS6_BCL2L1-01        ------------------------------------DTFVELYGNNAAAE
A0A2K5V0Q3_BCL2L2-      ------------------------------------STTDRGFPRARYRA
A0A2K5V0Q3_BCL2L2-      ------------------------------------STTDRGFPRARYRA
                                                                          

A0A2K5V0Q3_BCL2L2-      --------CGEAIGRLVLSSRLARANHGASYTS-----------------
A0A2K5V0Q3_BCL2L2-      ELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESL
A0A2K5V0Q3_BCL2L2-      ELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESL
A0A2K5V0Q3_BCL2L2-      ELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESL
A0A2K5V0Q3_BCL2L2-      ELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESL
A0A2K5V0Q3_BCL2L2-      ELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESL
A0A2K5W0Y7_MCL1-02      ---------GGIRNVLLAFAGVAGVGAGLAYLIR----------------
A0A2K5W0Y7_MCL1-03      -----------------------GISNKIALL------------------
A0A2K5W0Y7_MCL1-01      ---------GGIRNVLLAFAGVAGVGAGLAYLIR----------------
I7G687_MCL1-01          ---------GGIRNVLLAFAGVAGVGAGLAYLIR----------------
A0A2K5TKG9_BCL2L10      FWR------------KLLIQAFLACLLATAFGYLWTRLL-----------
A0A2K5V0Q3_BCL2L2-      ARRLRE---GNWASVRTVLTGAVALGALVTVGAFFASK------------
A0A7N9CNB8_BCL2-01      ----RPLFDFSWLSLKTLLSL-ALVGACITLGAYLGHK------------
A0A2K5VPG2_BCL2L1-      SRKGQERFN------RWFLTG-MTVAGVVLLGSLFSRK------------
A0A2K5VPG2_BCL2L1-      SRKGQERFN------RWFLTG-MTVAGVVLLGSLFSRK------------
Q2PFS6_BCL2L1-01        SRKGQERFN------RWFLTG-MTVAGVVLLGSLFSRK------------
A0A2K5TMD1_BCL2A1-      WIRQNGGWE------NGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC-
A0A2K5TMD1_BCL2A1-      WIRQNGGWG------K-----------WHNHMPM---LVESVAHKKKMAL
I7GKS6_BCL2L1-01        SRKGQERFN------RWFLTGMTV--AGVVLLGSLFSRK-----------
A0A2K5V0Q3_BCL2L2-      RTTNYNSSR------SRFYSGFNSRPRGRVYRAGLERHHGIPLTKKSVY-
A0A2K5V0Q3_BCL2L2-      RTTNYNSSR------SRFYSGFNSRPRGRVYRG-----RARATSWYSPY-
                                                                          

A0A2K5V0Q3_BCL2L2-      ------------------------------------------------RA
A0A2K5V0Q3_BCL2L2-      FRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNS
A0A2K5V0Q3_BCL2L2-      FRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNS
A0A2K5V0Q3_BCL2L2-      FRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNS
A0A2K5V0Q3_BCL2L2-      FRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNS
A0A2K5V0Q3_BCL2L2-      FRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNS
A0A2K5W0Y7_MCL1-02      --------------------------------------------------
A0A2K5W0Y7_MCL1-03      --------------------------------------------------
A0A2K5W0Y7_MCL1-01      --------------------------------------------------
I7G687_MCL1-01          --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A7N9CNB8_BCL2-01      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5V0Q3_BCL2L2-      RP------------------
A0A2K5V0Q3_BCL2L2-      RPRGRVYRSG----------
A0A2K5V0Q3_BCL2L2-      RPRGRVYRGRARATSWYSPY
A0A2K5V0Q3_BCL2L2-      RPRGRVYRGRARATSWFL--
A0A2K5V0Q3_BCL2L2-      RPRGRVYRSG----------
A0A2K5V0Q3_BCL2L2-      RPRGRVYRSG----------
A0A2K5W0Y7_MCL1-02      --------------------
A0A2K5W0Y7_MCL1-03      --------------------
A0A2K5W0Y7_MCL1-01      --------------------
I7G687_MCL1-01          --------------------
A0A2K5TKG9_BCL2L10      --------------------
A0A2K5V0Q3_BCL2L2-      --------------------
A0A7N9CNB8_BCL2-01      --------------------
A0A2K5VPG2_BCL2L1-      --------------------
A0A2K5VPG2_BCL2L1-      --------------------
Q2PFS6_BCL2L1-01        --------------------
A0A2K5TMD1_BCL2A1-      --------------------
A0A2K5TMD1_BCL2A1-      --------------------
I7GKS6_BCL2L1-01        --------------------
A0A2K5V0Q3_BCL2L2-      --------------------
A0A2K5V0Q3_BCL2L2-      --------------------
                                            

© 1998-2022Legal notice