Dataset for protein BCL-2-like of organism Macaca fascicularis

[Download (right click)] [Edit] [Sequences] [Repertoires]

21 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5V0Q3_BCL2L2-      MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKG-
A0A2K5V0Q3_BCL2L2-      MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKG-
A0A2K5V0Q3_BCL2L2-      MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKG-
A0A2K5V0Q3_BCL2L2-      MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKG-
A0A2K5V0Q3_BCL2L2-      MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKG-
A0A2K5V0Q3_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLRQKG-
A0A2K5W0Y7_MCL1-02      -----------------------------------------MFGLKRNAV
A0A2K5W0Y7_MCL1-03      -----------------------------------------MFGLKRNAV
A0A2K5W0Y7_MCL1-01      -----------------------------------------MFGLKRNAV
I7G687_MCL1-01          -----------------------------------------MFGLKRNAV
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      ------------------------MTDCEFGYIYRLAQDYLQY-------
A0A2K5TMD1_BCL2A1-      ------------------------MTDCEFGYIYRLAQDYLQY-------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLRQKGY
A0A7N9CNB8_BCL2-01      ----------------------MAHAGRTGYDNREIVMKYIHYKLSQRGY
A0A2K5VPG2_BCL2L1-      ----------------------------MSQSNRELVVDFLSYKLSQKGY
A0A2K5VPG2_BCL2L1-      ----------------------------MSQSNRELVVDFLSYKLSQKGY
Q2PFS6_BCL2L1-01        --------------------------------------------------
                                                                          

A0A2K5V0Q3_BCL2L2-      -----YVCGAGPGEGPAADP------------------------------
A0A2K5V0Q3_BCL2L2-      -----YVCGAGPGEGPAADP------------------------------
A0A2K5V0Q3_BCL2L2-      -----YVCGAGPGEGPAADP------------------------------
A0A2K5V0Q3_BCL2L2-      -----YVCGAGPGEGPAADP------------------------------
A0A2K5V0Q3_BCL2L2-      -----YVCGAGPGEGPAADP------------------------------
A0A2K5V0Q3_BCL2L2-      -----YVCGAGPGEGPAADP------------------------------
A0A2K5W0Y7_MCL1-02      IGLNLYCGGAGLGAGSGGAT-PGGRLL-----------------------
A0A2K5W0Y7_MCL1-03      IGLNLYCGGAGLGAGSGGAT-PGGRLLATEKEASARREIGGGEAGTVIGG
A0A2K5W0Y7_MCL1-01      IGLNLYCGGAGLGAGSGGAT-PGGRLLATEKEASARREIGGGEAGTVIGG
I7G687_MCL1-01          IGLNLYCGGAGLGAGSSGATPPGGRLLATEKEASARREIGGGEAGTVIGG
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A7N9CNB8_BCL2-01      EW--------DAGDVGAATP------------------------------
A0A2K5VPG2_BCL2L1-      SWSQFSDVEENRTEAPEGTE------------------------------
A0A2K5VPG2_BCL2L1-      SWSQFSDVEENRTEAPEGTE------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
                                                                          

A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5W0Y7_MCL1-02      --------------------------------------------------
A0A2K5W0Y7_MCL1-03      SAGASPR-ALTPDARRVARPPPIGAEVPDVTASPAR--FFAPTRRAGPLE
A0A2K5W0Y7_MCL1-01      SAGASPR-ALTPDARRVARPPPIGAEVPDVTASPAR--FFAPTRRAGPLE
I7G687_MCL1-01          SAGASPPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRRAAPLE
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A7N9CNB8_BCL2-01      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
                                                                          

A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5W0Y7_MCL1-02      --------------------------------------------------
A0A2K5W0Y7_MCL1-03      EMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGS
A0A2K5W0Y7_MCL1-01      EMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGS
I7G687_MCL1-01          EMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGS
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A7N9CNB8_BCL2-01      ----------------------------------------------GAAP
A0A2K5VPG2_BCL2L1-      ----------------------------------------------SEME
A0A2K5VPG2_BCL2L1-      ----------------------------------------------SEME
Q2PFS6_BCL2L1-01        ------------------------------------------------ME
                                                                          

A0A2K5V0Q3_BCL2L2-      -------------------------------------------------L
A0A2K5V0Q3_BCL2L2-      -------------------------------------------------L
A0A2K5V0Q3_BCL2L2-      -------------------------------------------------L
A0A2K5V0Q3_BCL2L2-      -------------------------------------------------L
A0A2K5V0Q3_BCL2L2-      -------------------------------------------------L
A0A2K5V0Q3_BCL2L2-      -------------------------------------------------L
A0A2K5W0Y7_MCL1-02      ------------------------------ATGAKDTKPMGRSGATSRKA
A0A2K5W0Y7_MCL1-03      LPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKA
A0A2K5W0Y7_MCL1-01      LPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKA
I7G687_MCL1-01          LPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKA
I7GKS6_BCL2L1-01        -------------------------------------------------M
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      ------------------------------------------------ME
A0A2K5TMD1_BCL2A1-      ---------------------VLQIPQPGSGPSKTSRVLQKVAFSVQKEV
A0A2K5TMD1_BCL2A1-      ---------------------VLQIPQPGSGPSKTSRVLQKVAFSVQKEV
A0A2K5TKG9_BCL2L10      -----------------TVESLRGRTMADPLRERTERLLADYLGPSTPEA
A0A2K5V0Q3_BCL2L2-      ---VCGAGPGEG--------------------------------PAADPL
A0A7N9CNB8_BCL2-01      APGIFSSQPGHPHPAASRDPVARTSPLPTPAAPAAAAVAGPALSPVPPVV
A0A2K5VPG2_BCL2L1-      TPSAINGNPSWH---------LVDSPAVNGATGHSSSLDAREVIPMAAVK
A0A2K5VPG2_BCL2L1-      TPSAINGNPSWH---------LVDSPAVNGATGHSSSLDAREVIPMAAVK
Q2PFS6_BCL2L1-01        TPSAINGNPSWH---------LVDSPAVNGATGHSSSLDAREVIPMAAVK
                                                                          

A0A2K5V0Q3_BCL2L2-      HQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG--G
A0A2K5V0Q3_BCL2L2-      HQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG--G
A0A2K5V0Q3_BCL2L2-      HQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG--G
A0A2K5V0Q3_BCL2L2-      HQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG--G
A0A2K5V0Q3_BCL2L2-      HQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG--G
A0A2K5V0Q3_BCL2L2-      HQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG--G
A0A2K5W0Y7_MCL1-02      LETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSD--G
A0A2K5W0Y7_MCL1-03      LETLRRVGDGVQRNHETAFQGWVCGV-----------------LPCR--G
A0A2K5W0Y7_MCL1-01      LETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSD--G
I7G687_MCL1-01          LETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSD--G
I7GKS6_BCL2L1-01        WKRTGLRPQKGLNRRWRPPVPSMATHPGTPGTAYQSFEQVVNELFRD--G
A0A2K5V0Q3_BCL2L2-      ------------------------------MSIEEKMEADARSIYVG--N
A0A2K5V0Q3_BCL2L2-      EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG--N
A0A2K5TMD1_BCL2A1-      EKNLKPCLDNVNVA--------------SIDTARTLFNQVMEKEFEDG-I
A0A2K5TMD1_BCL2A1-      EKNLKPCLDNVNVA--------------SIDTARTLFNQVMEKEFEDG-I
A0A2K5TKG9_BCL2L10      A-VLRSAAARLRQLHRSFFSAYRG----YPGNRVELVALMAEAVLSDSPG
A0A2K5V0Q3_BCL2L2-      HQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG--G
A0A7N9CNB8_BCL2-01      HLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD--G
A0A2K5VPG2_BCL2L1-      Q-ALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQ-----------
A0A2K5VPG2_BCL2L1-      Q-ALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRD--G
Q2PFS6_BCL2L1-01        Q-ALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRD--G
                                                                          

A0A2K5V0Q3_BCL2L2-      P-NWGRLVAFFV--FGAALC------------------AESVNKEMEPLV
A0A2K5V0Q3_BCL2L2-      P-NWGRLVAFFV--FGAALC------------------AESVNKEMEPLV
A0A2K5V0Q3_BCL2L2-      P-NWGRLVAFFV--FGAALC------------------AESVNKEMEPLV
A0A2K5V0Q3_BCL2L2-      P-NWGRLVAFFV--FGAALC------------------AESVNKEMEPLV
A0A2K5V0Q3_BCL2L2-      P-NWGRLVAFFV--FGAALC------------------AESVNKEMEPLV
A0A2K5V0Q3_BCL2L2-      P-NWGRLVAFFV--FGAALC------------------AESVNKEMEPLV
A0A2K5W0Y7_MCL1-02      VTNWGRIVTLIS--FGAFVA------------------KHLKTINQESCI
A0A2K5W0Y7_MCL1-03      PRRW-----------------------------------------HQKCA
A0A2K5W0Y7_MCL1-01      VTNWGRIVTLIS--FGAFVA------------------KHLKTINQESCI
I7G687_MCL1-01          VTNWGRIVTLIS--FGAFVA------------------KHLKTINQESCI
I7GKS6_BCL2L1-01        V-NWGRIVAFFS--FGGALC------------------VESVDKEMQVLV
A0A2K5V0Q3_BCL2L2-      V-DYGATAEELEAHFHGCGS------------------VNRVTILCDKFS
A0A2K5V0Q3_BCL2L2-      V-DYGATAEELEAHFHGCGS------------------VNRVTILCDKFS
A0A2K5TMD1_BCL2A1-      I-NWGRIVTIFA--FEGILI------------------KKLLRQRIAPDV
A0A2K5TMD1_BCL2A1-      I-NWGRIVTIFA--FEGILI------------------KKLLRQRIAPDV
A0A2K5TKG9_BCL2L10      P-TWGRVVSLVT--FAGTLLEREPLVTAWWKKRGFQPRLKEQEGDVARDC
A0A2K5V0Q3_BCL2L2-      P-NWGRLVAFFV--FGAALC------------------AESVNKEMEPLV
A0A7N9CNB8_BCL2-01      V-NWGRIVAFFE--FGGVMC------------------VESVNREMSPLV
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      V-NWGRIVAFFS--FGGALC------------------VESVDKEMQVLV
Q2PFS6_BCL2L1-01        V-NWGRIVAFFS--FGGALC------------------VESVDKEMQVLV
                                                                          

A0A2K5V0Q3_BCL2L2-      G---QVQEWMVAYLET--------------------RLADWIHSSGGWLS
A0A2K5V0Q3_BCL2L2-      G---QVQEWMVAYLET--------------------RLADWIHSSGGW--
A0A2K5V0Q3_BCL2L2-      G---QVQEWMVAYLET--------------------RLADWIHSSGGWLS
A0A2K5V0Q3_BCL2L2-      G---QVQEWMVAYLET--------------------RLADWIHSSGGWLS
A0A2K5V0Q3_BCL2L2-      G---QVQEWMVAYLET--------------------RLADWIHSSGGWLS
A0A2K5V0Q3_BCL2L2-      G---QVQEWMVAYLET--------------------RLADWIHSSGGWLS
A0A2K5W0Y7_MCL1-02      E---PLAESITDVLVR--------------------TKRDWLVKQRGW--
A0A2K5W0Y7_MCL1-03      A---GFCRCCWS--------------------------RSWF--------
A0A2K5W0Y7_MCL1-01      E---PLAESITDVLVR--------------------TKRDWLVKQRGW--
I7G687_MCL1-01          E---PLAESITDVLVR--------------------TKRDWLVKQRGW--
I7GKS6_BCL2L1-01        S---RIAAWMATYLND--------------------HLEPWIQENGGW--
A0A2K5V0Q3_BCL2L2-      G---HPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGI--
A0A2K5V0Q3_BCL2L2-      G---HPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGI--
A0A2K5TMD1_BCL2A1-      DTYKEISYFVAEFIMN--------------------NTGEWIRQNGGW--
A0A2K5TMD1_BCL2A1-      DTYKEISYFVAEFIMN--------------------NTGEWIRQNGGW--
A0A2K5TKG9_BCL2L10      Q---RLVALLSSRLAG--------------------STAPGFRLRA----
A0A2K5V0Q3_BCL2L2-      G---QVQEWMVAYLET--------------------RLADWIHSSGGW--
A0A7N9CNB8_BCL2-01      D---NIALWMTEYLNR--------------------HLHTWIQDNGGW--
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      S---RIAAWMATYLND--------------------HLEPWIQENGGW--
Q2PFS6_BCL2L1-01        S---RIAAWMATYLND--------------------HLEPWIQENGGW--
                                                                          

A0A2K5V0Q3_BCL2L2-      QITEAEMADEVICSEILSDCDSAPSSPDLE------------FEAGQSVR
A0A2K5V0Q3_BCL2L2-      ------------------------------ELEAIKARVREMEEEAEKLK
A0A2K5V0Q3_BCL2L2-      QITEAEMADEVICSEILSDCDSAPSSPDLEELEAIKARVREMEEEAEKLK
A0A2K5V0Q3_BCL2L2-      QITEAEMADEVICSEILSDCDSAPSSPDLEELEAIKARVREMEEEAEKLK
A0A2K5V0Q3_BCL2L2-      QITEAEMADEVICSEILSDCDSAPSSPDLEELEAIKARVREMEEEAEKLK
A0A2K5V0Q3_BCL2L2-      QITEAEMADEVICSEILSDCDSAPSSPDLEELEAIKARVREMEEEAEKLK
A0A2K5W0Y7_MCL1-02      --------------------DGFVEFFHVEDLE-----------------
A0A2K5W0Y7_MCL1-03      --------------------------------------------------
A0A2K5W0Y7_MCL1-01      --------------------DGFVEFFHVEDLE-----------------
I7G687_MCL1-01          --------------------DGFVEFFHVEDLE-----------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A7N9CNB8_BCL2-01      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
                                                                          

A0A2K5V0Q3_BCL2L2-      GQGSPVTKRVSLL---------------RISRANQHLRLGH---------
A0A2K5V0Q3_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A2K5V0Q3_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A2K5V0Q3_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A2K5V0Q3_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A2K5V0Q3_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A2K5W0Y7_MCL1-02      --------------------------------------------------
A0A2K5W0Y7_MCL1-03      --------------------------------------------------
A0A2K5W0Y7_MCL1-01      --------------------------------------------------
I7G687_MCL1-01          --------------------------------------------------
I7GKS6_BCL2L1-01        ------------------------------------------------DT
A0A2K5V0Q3_BCL2L2-      ------------------------------------------------ST
A0A2K5V0Q3_BCL2L2-      ------------------------------------------------ST
A0A2K5TMD1_BCL2A1-      ------------------------------------------------EN
A0A2K5TMD1_BCL2A1-      ------------------------------------------------GK
A0A2K5TKG9_BCL2L10      ------------------------------------------------DG
A0A2K5V0Q3_BCL2L2-      ------------------------------------------------AE
A0A7N9CNB8_BCL2-01      ------------------------------------------------DA
A0A2K5VPG2_BCL2L1-      ------------------------------------------------DT
A0A2K5VPG2_BCL2L1-      ------------------------------------------------DT
Q2PFS6_BCL2L1-01        ------------------------------------------------DT
                                                                          

A0A2K5V0Q3_BCL2L2-      -------CGEAIGRLVLSSRLARANHGASYTS------------------
A0A2K5V0Q3_BCL2L2-      LEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLF
A0A2K5V0Q3_BCL2L2-      LEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLF
A0A2K5V0Q3_BCL2L2-      LEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLF
A0A2K5V0Q3_BCL2L2-      LEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLF
A0A2K5V0Q3_BCL2L2-      LEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLF
A0A2K5W0Y7_MCL1-02      --------GGIRNVLLAFAGVAGVGAGLAYLIR-----------------
A0A2K5W0Y7_MCL1-03      ----------------------GISNKIALL-------------------
A0A2K5W0Y7_MCL1-01      --------GGIRNVLLAFAGVAGVGAGLAYLIR-----------------
I7G687_MCL1-01          --------GGIRNVLLAFAGVAGVGAGLAYLIR-----------------
I7GKS6_BCL2L1-01        -FVELYGNNAAAESRKGQERFNR-----WFLTGMTV--AGVVLL------
A0A2K5V0Q3_BCL2L2-      -TDRGFPRARYRARTTNYNSSRS-----RFYSGFNSRPRGRVYR------
A0A2K5V0Q3_BCL2L2-      -TDRGFPRARYRARTTNYNSSRS-----RFYSGFNSRPRGRVYR------
A0A2K5TMD1_BCL2A1-      GFVKKFEPKS------------------GWMTFLEVTGKICEML------
A0A2K5TMD1_BCL2A1-      -----------------------------WHNHMPM---LVESV------
A0A2K5TKG9_BCL2L10      -FCHFFRSPFPLAFWR------------KLLIQAFLACLLATAF------
A0A2K5V0Q3_BCL2L2-      -FTALYGDGALEEARRLRE---GNWASVRTVLTGAVALGALVTV------
A0A7N9CNB8_BCL2-01      -FVELYGPSM-------RPLFDFSWLSLKTLLSL-ALVGACITL------
A0A2K5VPG2_BCL2L1-      -FVELYGNNAAAESRKGQERFN------RWFLTG-MTVAGVVLL------
A0A2K5VPG2_BCL2L1-      -FVELYGNNAAAESRKGQERFN------RWFLTG-MTVAGVVLL------
Q2PFS6_BCL2L1-01        -FVELYGNNAAAESRKGQERFN------RWFLTG-MTVAGVVLL------
                                                                          

A0A2K5V0Q3_BCL2L2-      -----------------------------------------------RAR
A0A2K5V0Q3_BCL2L2-      RGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSR
A0A2K5V0Q3_BCL2L2-      RGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSR
A0A2K5V0Q3_BCL2L2-      RGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSR
A0A2K5V0Q3_BCL2L2-      RGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSR
A0A2K5V0Q3_BCL2L2-      RGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSR
A0A2K5W0Y7_MCL1-02      --------------------------------------------------
A0A2K5W0Y7_MCL1-03      --------------------------------------------------
A0A2K5W0Y7_MCL1-01      --------------------------------------------------
I7G687_MCL1-01          --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A7N9CNB8_BCL2-01      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
                                                                          

A0A2K5V0Q3_BCL2L2-      P------------------
A0A2K5V0Q3_BCL2L2-      PRGRVYRSG----------
A0A2K5V0Q3_BCL2L2-      PRGRVYRSG----------
A0A2K5V0Q3_BCL2L2-      PRGRVYRGRARATSWYSPY
A0A2K5V0Q3_BCL2L2-      PRGRVYRGRARATSWFL--
A0A2K5V0Q3_BCL2L2-      PRGRVYRSG----------
A0A2K5W0Y7_MCL1-02      -------------------
A0A2K5W0Y7_MCL1-03      -------------------
A0A2K5W0Y7_MCL1-01      -------------------
I7G687_MCL1-01          -------------------
I7GKS6_BCL2L1-01        --GSLFSRK----------
A0A2K5V0Q3_BCL2L2-      --G-----RARATSWYSPY
A0A2K5V0Q3_BCL2L2-      --AGLERHHGIPLTKKSVY
A0A2K5TMD1_BCL2A1-      --SLLKQYC----------
A0A2K5TMD1_BCL2A1-      --AHKKKMAL---------
A0A2K5TKG9_BCL2L10      --GYLWTRLL---------
A0A2K5V0Q3_BCL2L2-      --GAFFASK----------
A0A7N9CNB8_BCL2-01      --GAYLGHK----------
A0A2K5VPG2_BCL2L1-      --GSLFSRK----------
A0A2K5VPG2_BCL2L1-      --GSLFSRK----------
Q2PFS6_BCL2L1-01        --GSLFSRK----------
                                           

© 1998-2022Legal notice