Dataset for protein BCL-2-like of organism Macaca fascicularis

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKG-----------------------
A0A2K5W0W9_MCL1-01      -------------------MFGLKRNAV----------------------
I7G687_MCL1-01          -------------------MFGLKRNAV----------------------
A0A2K5V0Q3_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGY----------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5UDI5_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAATPGAAPAPGIFS
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPE----G
Q2PFS6_BCL2L1-01        --------------------------------------------------
A0A2K5TKG9_BCL2L10      -------------------------------------MADPLRERTERLL
A0A2K5W0W9_MCL1-03      ----------------------------------------MFGLKRNAVI
                                                                          

A0A2K5TMD1_BCL2A1-      ---------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKT-SRVLQKV
A0A2K5TMD1_BCL2A1-      ---------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKT-SRVLQKV
A0A2K5V0Q3_BCL2L2-      ------------------------------YVCGAGPGEGPA-ADPLHQA
A0A2K5W0W9_MCL1-01      -------------------------IGLNLYCGGAGLGAGSGGATPPGGR
I7G687_MCL1-01          -------------------------IGLNLYCGGAGLGAGSSGATPPGGR
A0A2K5V0Q3_BCL2L2-      -------------------------------VCGAGPGEGPA-ADPLHQA
I7GKS6_BCL2L1-01        ---------------MWKRTGLRPQKG-----------------------
A0A2K5UDI5_BCL2-01      SQPGHTPHPAASRDPVARTSPLPTPAAPAAAAAAAGPALSPV-PPVVHLT
A0A2K5VPG2_BCL2L1-      ---------------MWKRTGLRPQKG-----------------------
A0A2K5VPG2_BCL2L1-      TESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREVIP-MAAVKQA
Q2PFS6_BCL2L1-01        ----METPSAINGNPSWHLVDSPAVNGATGHSSSLDAREVIP-MAAVKQA
A0A2K5TKG9_BCL2L10      ADYLGCCAR-----------------EPGTPEPRPSTPEAAV-LRSAAAR
A0A2K5W0W9_MCL1-03      GLNLYCGGAGLGAGSGGATPPGGRLLATGAKDTKPMGRSGAT-SRKALET
                                                                          

A0A2K5TMD1_BCL2A1-      AFSVQKEVEKNLKPCLDNVNVA---SIDTARTLFNQVMEKEFEDGI-INW
A0A2K5TMD1_BCL2A1-      AFSVQKEVEKNLKPCLDNVNVA---SIDTARTLFNQVMEKEFEDGI-INW
A0A2K5V0Q3_BCL2L2-      MRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGP--NW
A0A2K5W0W9_MCL1-01      LLATEKEASARREIGGGEAGTVIGGSAGASPP------------------
I7G687_MCL1-01          LLATEKEASARREIGGGEAGTVIGGSAGASPP------------------
A0A2K5V0Q3_BCL2L2-      MRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGP--NW
I7GKS6_BCL2L1-01        -------LNRRWRPPVPSMATH-PGTPGTAYQSFEQVVNELFRDGV--NW
A0A2K5UDI5_BCL2-01      LRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGV--NW
A0A2K5VPG2_BCL2L1-      -------LNRRWRPPVPSMATH----PGTAYQSFEQVVNELFRDGV--NW
A0A2K5VPG2_BCL2L1-      LREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGV--NW
Q2PFS6_BCL2L1-01        LREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGV--NW
A0A2K5TKG9_BCL2L10      LRQ----LHRSFFSAYRGY-------PGNRVELVALMAEAVLSDSPGPTW
A0A2K5W0W9_MCL1-03      LRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGV-TNW
                                                                          

A0A2K5TMD1_BCL2A1-      GRIVTIFAFEGILIKKLLRQ------------------RIAPDVDTYKEI
A0A2K5TMD1_BCL2A1-      GRIVTIFAFEGILIKKLLRQ------------------RIAPDVDTYKEI
A0A2K5V0Q3_BCL2L2-      GRLVAFFVFGAALCAESVNK------------------EMEPLVG---QV
A0A2K5W0W9_MCL1-01      ----------AALTPDARRV------------------ARPPPIG-----
I7G687_MCL1-01          ----------AALTPDARRV------------------ARPPPIG-----
A0A2K5V0Q3_BCL2L2-      GRLVAFFVFGAALCAESVNK------------------EMEPLVG---QV
I7GKS6_BCL2L1-01        GRIVAFFSFGGALCVESVDK------------------EMQVLVS---RI
A0A2K5UDI5_BCL2-01      GRIVAFFEFGGVMCVESVNR------------------EMSPLVD---NI
A0A2K5VPG2_BCL2L1-      GRIVAFFSFGGALCVESVDK------------------EMQVLVS---RI
A0A2K5VPG2_BCL2L1-      GRIVAFFSFGGALCVESVDK------------------EMQVLVS---RI
Q2PFS6_BCL2L1-01        GRIVAFFSFGGALCVESVDK------------------EMQVLVS---RI
A0A2K5TKG9_BCL2L10      GRVVSLVTFAGTLLEREPLVTAWWKKRGFQPRLKEQEGDVARDCQ---RL
A0A2K5W0W9_MCL1-03      GRIVTLISFGAFVAKHLKTI------------------NQESCIE---PL
                                  . :                                     

A0A2K5TMD1_BCL2A1-      SYFVAEFIMNNTGEWIRQNGGWGK--------------------------
A0A2K5TMD1_BCL2A1-      SYFVAEFIMNNTGEWIRQNGGWENGF------------------------
A0A2K5V0Q3_BCL2L2-      QEWMVAYLETRLADWIHSSGGWELEAIKARVREMEE-EAEKLKELQNEVE
A0A2K5W0W9_MCL1-01      ---------AEVPDVTASPARLLFFAPTRRAGPLEEMEAPAADAIMSPEE
I7G687_MCL1-01          ---------AEVPDVTASPARLLFFAPTRRAAPLEEMEAPAADAIMSPEE
A0A2K5V0Q3_BCL2L2-      QEWMVAYLETRLADWIHSSGGWAEFT-----------ALYGDGALEEARR
I7GKS6_BCL2L1-01        AAWMATYLNDHLEPWIQENGGWDTFV-----------ELYGNNAAAESRK
A0A2K5UDI5_BCL2-01      ALWMTEYLNRHLHTWIQDNGGWDAFV-----------ELYGPSM------
A0A2K5VPG2_BCL2L1-      AAWMATYLNDHLEPWIQENGGWDTFV-----------ELYGNNAAAESRK
A0A2K5VPG2_BCL2L1-      AAWMATYLNDHLEPWIQENGGWDTFV-----------ELYGNNAAAESRK
Q2PFS6_BCL2L1-01        AAWMATYLNDHLEPWIQENGGWDTFV-----------ELYGNNAAAESRK
A0A2K5TKG9_BCL2L10      VALLSSRLAGQHRAWLQAQGGWDGFC-----------HFFRSPFPLAFWR
A0A2K5W0W9_MCL1-03      AESITDVLVRTKRDWLVKQRGWDGFV-----------EFFHVEDLEGGIR
                                                                          

A0A2K5TMD1_BCL2A1-      ----------WHNHMPM---LV----------------------------
A0A2K5TMD1_BCL2A1-      -VKKFEPKSGWMTFLEVTGKIC----------------------------
A0A2K5V0Q3_BCL2L2-      KQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNV--DYGATAEELEAHF
A0A2K5W0W9_MCL1-01      ELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGSLPSTPPPAEEEEDEL
I7G687_MCL1-01          ELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGSLPSTPPPAEEEEDEL
A0A2K5V0Q3_BCL2L2-      LRE---GNWASVRTVLTGAVAL----------------------------
I7GKS6_BCL2L1-01        GQERFN------RWFLTG-MTV----------------------------
A0A2K5UDI5_BCL2-01      -RPLFDFSWLSLKTLLSL-ALV----------------------------
A0A2K5VPG2_BCL2L1-      GQERFN------RWFLTG-MTV----------------------------
A0A2K5VPG2_BCL2L1-      GQERFN------RWFLTG-MTV----------------------------
Q2PFS6_BCL2L1-01        GQERFN------RWFLTG-MTV----------------------------
A0A2K5TKG9_BCL2L10      ------------KLLIQAFLAC----------------------------
A0A2K5W0W9_MCL1-03      ------------NVLLAFAGVA----------------------------
                                                                          

A0A2K5TMD1_BCL2A1-      ------ESVAHKKKMAL---------------------------------
A0A2K5TMD1_BCL2A1-      ------EMLSLLKQYC----------------------------------
A0A2K5V0Q3_BCL2L2-      HGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALD---------
A0A2K5W0W9_MCL1-01      YR----QSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGV
I7G687_MCL1-01          YR----QSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGV
A0A2K5V0Q3_BCL2L2-      ------GALVTVGAFFASK-------------------------------
I7GKS6_BCL2L1-01        ------AGVVLLGSLFSRK-------------------------------
A0A2K5UDI5_BCL2-01      ------GACITLGAYLGHK-------------------------------
A0A2K5VPG2_BCL2L1-      ------AGVVLLGSLFSRK-------------------------------
A0A2K5VPG2_BCL2L1-      ------AGVVLLGSLFSRK-------------------------------
Q2PFS6_BCL2L1-01        ------AGVVLLGSLFSRK-------------------------------
A0A2K5TKG9_BCL2L10      ------LLATAFGYLWTRLL------------------------------
A0A2K5W0W9_MCL1-03      ------GVGAGLAYLIR---------------------------------
                                                                          

A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      ----ESLFRGRQIKV------IPKRTNRPGISTTDRGFPRARYRARTTNY
A0A2K5W0W9_MCL1-01      QRNHETAFQGWVCGV-----------------LPCRGPRRW---------
I7G687_MCL1-01          QRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISF
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5UDI5_BCL2-01      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
                                                                          

A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      NSSRSRFYSGFNSRPRGRVYRGRARA------TSWYSPY-----------
A0A2K5W0W9_MCL1-01      ------------HQKCAAGFCRCCWS------RSWF--------------
I7G687_MCL1-01          GAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5UDI5_BCL2-01      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
                                                                          

A0A2K5TMD1_BCL2A1-      ------------------------------
A0A2K5TMD1_BCL2A1-      ------------------------------
A0A2K5V0Q3_BCL2L2-      ------------------------------
A0A2K5W0W9_MCL1-01      -------------------GISNKIALL--
I7G687_MCL1-01          VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A2K5V0Q3_BCL2L2-      ------------------------------
I7GKS6_BCL2L1-01        ------------------------------
A0A2K5UDI5_BCL2-01      ------------------------------
A0A2K5VPG2_BCL2L1-      ------------------------------
A0A2K5VPG2_BCL2L1-      ------------------------------
Q2PFS6_BCL2L1-01        ------------------------------
A0A2K5TKG9_BCL2L10      ------------------------------
A0A2K5W0W9_MCL1-03      ------------------------------
                                                      

© 1998-2020Legal notice