Dataset for protein BCL-2-like of organism Macaca fascicularis

[Download (right click)] [Alignment] [Repertoires]

21 sequence(s)

>gnl|bcl2dbpro|A0A2K5TKG9_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L10 (length=189 residues).
TVESLRGRTMADPLRERTERLLADYLGPSTPEAAVLRSAAARLRQLHRSFFSAYRGYPGNRVELVALMAEAVLSDSPGPT
WGRVVSLVTFAGTLLEREPLVTAWWKKRGFQPRLKEQEGDVARDCQRLVALLSSRLAGSTAPGFRLRADGFCHFFRSPFP
LAFWRKLLIQAFLACLLATAFGYLWTRLL
>gnl|bcl2dbpro|A0A2K5TMD1_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2A1 (length=175 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYC
>gnl|bcl2dbpro|A0A2K5TMD1_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2A1 (length=162 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHMPMLVESVAHKKKM
AL
>gnl|bcl2dbpro|A0A2K5V0Q3_BCL2L2-04 BCL2-like 2 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L2 (length=388 residues).
MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRF
RRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
IHSSGGWLSQITEAEMADEVICSEILSDCDSAPSSPDLEELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGP
VIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFR
GRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
>gnl|bcl2dbpro|A0A2K5V0Q3_BCL2L2-09 BCL2-like 2 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L2 (length=146 residues).
MSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGR
QIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
>gnl|bcl2dbpro|A0A2K5V0Q3_BCL2L2-08 BCL2-like 2 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L2 (length=183 residues).
MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKF
SGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRP
RGRVYRAGLERHHGIPLTKKSVY
>gnl|bcl2dbpro|A0A2K5V0Q3_BCL2L2-07 BCL2-like 2 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L2 (length=262 residues).
MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRF
RRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
IHSSGGWLSQITEAEMADEVICSEILSDCDSAPSSPDLEFEAGQSVRGQGSPVTKRVSLLRISRANQHLRLGHCGEAIGR
LVLSSRLARANHGASYTSRARP
>gnl|bcl2dbpro|A0A2K5V0Q3_BCL2L2-06 BCL2-like 2 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L2 (length=346 residues).
MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRF
RRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
IHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEA
HFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRART
TNYNSSRSRFYSGFNSRPRGRVYRSG
>gnl|bcl2dbpro|A0A2K5V0Q3_BCL2L2-05 BCL2-like 2 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L2 (length=378 residues).
MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRF
RRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
IHSSGGWLSQITEAEMADEVICSEILSDCDSAPSSPDLEELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGP
VIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFR
GRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG
>gnl|bcl2dbpro|A0A2K5V0Q3_BCL2L2-03 BCL2-like 2 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L2 (length=386 residues).
MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRF
RRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
IHSSGGWLSQITEAEMADEVICSEILSDCDSAPSSPDLEELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGP
VIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFR
GRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWFL
>gnl|bcl2dbpro|A0A2K5V0Q3_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L2 (length=355 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWLSQITEAEMADEVICS
EILSDCDSAPSSPDLEELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDY
GATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGF
PRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG
>gnl|bcl2dbpro|A0A2K5V0Q3_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A2K5VPG2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L1 (length=170 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGV
VLLGSLFSRK
>gnl|bcl2dbpro|A0A2K5VPG2_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K5W0Y7_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Macaca fascicularis GN=MCL-1 (length=267 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPGGRLLATEKEASARREIGGGEAGTVIGGSAGASPRALTPDARRVARPPPI
GAEVPDVTASPARFFAPTRRAGPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGSLPSTP
PPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGWVCGVLPCRGPRRW
HQKCAAGFCRCCWSRSWFGISNKIALL
>gnl|bcl2dbpro|A0A2K5W0Y7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Macaca fascicularis GN=MCL-1 (length=346 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPGGRLLATEKEASARREIGGGEAGTVIGGSAGASPRALTPDARRVARPPPI
GAEVPDVTASPARFFAPTRRAGPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGSLPSTP
PPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVK
SLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDL
EGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A2K5W0Y7_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Macaca fascicularis GN=MCL-1 (length=196 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPGGRLLATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRK
LDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDG
FVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A7N9CNB8_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Macaca fascicularis GN=BCL-2 (length=240 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAATPGAAPAPGIFSSQPGHPHPAASRDPVARTSPLPTPAAPAAA
AVAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCV
ESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|I7G687_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Macaca fascicularis GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSSGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPP
PIGAEVPDVTASPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|I7GKS6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L1 (length=148 residues).
MWKRTGLRPQKGLNRRWRPPVPSMATHPGTPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSR
IAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|Q2PFS6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L1 (length=189 residues).
METPSAINGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFE
QVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESR
KGQERFNRWFLTGMTVAGVVLLGSLFSRK
© 1998-2022Legal notice