Dataset for protein Bcl-w of organism Macaca fascicularis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                               .: :             
mpllilspyihasvsslpliaarmatpasapdtralvadfvgyklrqkgyvcgagpgegpaadplhqamraagdefetrf
--------------------------------------------------------------msiee-------------
                              meee eklkelqnevekqmnmspppgna  vi                  
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
rrtfsdlaaqlhvtpgsaqqrftqvsdelfqggpnwgrlvaffvfgaalcaesvnkemeplvgqvqewmvayletrladw
--------------------------------------------------------------------------------
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ihssggwlsqiteaemadevicseilsdcdsapsspdleeleaikarvremeeeaeklkelqnevekqmnmspppgnagp
--------------------------------------------------------------------------------
                                                   f agqsvrgqgsp t rvsll        
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
        :      :                       ...     :  . :       .  ::               
vimsieekmeadarsiyvgnvdygataeeleahfh---gcgsvnrvtilcdkfsghp---kgfayiefsdkesvrtslal
-------risranqhl---h---------------vtp-saqqrgtqvsssrlqrgnnwgrlvsftv-------------
       a r  gdefrl etrfrr fsd a ql       eaifrl  del a a    h a  fs gaalcaesvnke
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
deslfrgrqikvipkrtnrpg------------isttdrgfpraryrarttnynssrsrfysgfnsrprgrvyrg-----
---------------------dwihssggwaef-----------------------------------------sglvtv
m p vgqv ewmvaylet la            talygd aleear l eg wa v tvl    ra  t a al-a erh
                                                                          a     

       410 
....:....|.
           
g----------
raratswyspy
-gipltkklv 
h ffa  f   
© 1998-2022Legal notice