Dataset for protein Bcl-w of organism Macaca fascicularis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
mpllilspyihasvsslpliaarmatpasapdtralvadfvgyklrqkgyvcgagpgegpaadplhqamraagdefetrf
--------------------------------------------------------------------------------
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
rrtfsdlaaqlhvtpgsaqqrftqvsdelfqggpnwgrlvaffvfgaalcaesvnkemeplvgqvqewmvayletrladw
--------------------------------------------------------------------------------
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ihssggwlsqiteaemadevicseilsdcdsapsspdleeleaikarvremeeeaeklkelqnevekqmnmspppgnagp
----------------------------------------------------------r---------------------
                                        a ftalygdgal agrsv-gqnwp t rvsll        
                                                   f   qr   ggs                 

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             . :  *                                                             
vimsieekmeadarsiyvGnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesvrtslaldeslfr
----------rsvqtvrt h------------------------------------------------------------
       ris an hlll a al               eaigrlv ssrlaranh as ts           vtvgaf a
                                                                                

       330       340       350       360       370       380       390   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
                                                                         
grqikvipkrtnrpgisttdrgfpraryrarttnynssrsrfysgfnsrprgrvyrs-----r----------
--------------------------------------------------------gglerhgaratswyspy
sk                                            ra        -     -gipltkklv 
                                                        a     h      f   
© 1998-2022Legal notice