Dataset for protein Bcl-w of organism Macaca fascicularis

[Download (right click)] [Alignment] [Repertoires]

9 sequence(s)

>gnl|bcl2dbpro|A0A2K5V0Q3_BCL2L2-09 BCL2-like 2 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L2 (length=146 residues).
MSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGR
QIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
>gnl|bcl2dbpro|A0A2K5V0Q3_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A2K5V0Q3_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L2 (length=355 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWLSQITEAEMADEVICS
EILSDCDSAPSSPDLEELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDY
GATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGF
PRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG
>gnl|bcl2dbpro|A0A2K5V0Q3_BCL2L2-03 BCL2-like 2 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L2 (length=386 residues).
MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRF
RRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
IHSSGGWLSQITEAEMADEVICSEILSDCDSAPSSPDLEELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGP
VIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFR
GRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWFL
>gnl|bcl2dbpro|A0A2K5V0Q3_BCL2L2-04 BCL2-like 2 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L2 (length=388 residues).
MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRF
RRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
IHSSGGWLSQITEAEMADEVICSEILSDCDSAPSSPDLEELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGP
VIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFR
GRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
>gnl|bcl2dbpro|A0A2K5V0Q3_BCL2L2-05 BCL2-like 2 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L2 (length=378 residues).
MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRF
RRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
IHSSGGWLSQITEAEMADEVICSEILSDCDSAPSSPDLEELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGP
VIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFR
GRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG
>gnl|bcl2dbpro|A0A2K5V0Q3_BCL2L2-06 BCL2-like 2 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L2 (length=346 residues).
MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRF
RRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
IHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEA
HFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRART
TNYNSSRSRFYSGFNSRPRGRVYRSG
>gnl|bcl2dbpro|A0A2K5V0Q3_BCL2L2-07 BCL2-like 2 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L2 (length=262 residues).
MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRF
RRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
IHSSGGWLSQITEAEMADEVICSEILSDCDSAPSSPDLEFEAGQSVRGQGSPVTKRVSLLRISRANQHLRLGHCGEAIGR
LVLSSRLARANHGASYTSRARP
>gnl|bcl2dbpro|A0A2K5V0Q3_BCL2L2-08 BCL2-like 2 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L2 (length=183 residues).
MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKF
SGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRP
RGRVYRAGLERHHGIPLTKKSVY
© 1998-2021Legal notice