Dataset for protein Bcl-w of organism Macaca fascicularis

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A2K5V0Q3_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A2K5V0Q3_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L2 (length=333 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
RGRARATSWYSPY
>gnl|bcl2dbpro|A0A2K5V0Q3_BCL2L2-04 BCL2-like 2 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L2 (length=268 residues).
MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPEELLLEPEPEPEPEEEPPRPRAE
LEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSV
NRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRS
RFYSGFNSRPRGRVYRGRARATSWYSPY
>gnl|bcl2dbpro|A0A2K5V0Q3_BCL2L2-03 BCL2-like 2 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L2 (length=178 residues).
MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKF
SGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRP
RGRVYRGRARATSWYSPY
© 1998-2020Legal notice