Dataset for protein Bcl-w of organism Macaca fascicularis

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5V0Q3_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLRQKGY
A0A2K5V0Q3_BCL2L2-      MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGY
A0A2K5V0Q3_BCL2L2-      MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGY
A0A2K5V0Q3_BCL2L2-      MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGY
A0A2K5V0Q3_BCL2L2-      MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGY
A0A2K5V0Q3_BCL2L2-      MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGY
A0A2K5V0Q3_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLRQKGY
A0A2K5V0Q3_BCL2L2-      ------------------------------MEEEAEKLKELQNEVEKQMN
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5V0Q3_BCL2L2-      VCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQ
A0A2K5V0Q3_BCL2L2-      VCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQ
A0A2K5V0Q3_BCL2L2-      VCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQ
A0A2K5V0Q3_BCL2L2-      VCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQ
A0A2K5V0Q3_BCL2L2-      VCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQ
A0A2K5V0Q3_BCL2L2-      VCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQ
A0A2K5V0Q3_BCL2L2-      VCGAGPGEGPAADPLHQ---------------------------------
A0A2K5V0Q3_BCL2L2-      MSPPPGNAGPVIMSIEE---------------------------------
A0A2K5V0Q3_BCL2L2-      ------------MSIEE---------------------------------
                                     .: :                                 

A0A2K5V0Q3_BCL2L2-      RFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMV
A0A2K5V0Q3_BCL2L2-      RFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMV
A0A2K5V0Q3_BCL2L2-      RFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMV
A0A2K5V0Q3_BCL2L2-      RFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMV
A0A2K5V0Q3_BCL2L2-      RFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMV
A0A2K5V0Q3_BCL2L2-      RFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMV
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5V0Q3_BCL2L2-      AYLETRLADWIHSSGGWLSQITEAEMADEVICSEILSDCDSAPSSPDLEE
A0A2K5V0Q3_BCL2L2-      AYLETRLADWIHSSGGWLSQITEAEMADEVICSEILSDCDSAPSSPDLE-
A0A2K5V0Q3_BCL2L2-      AYLETRLADWIHSSGGW--------------------------------E
A0A2K5V0Q3_BCL2L2-      AYLETRLADWIHSSGGWLSQITEAEMADEVICSEILSDCDSAPSSPDLEE
A0A2K5V0Q3_BCL2L2-      AYLETRLADWIHSSGGWLSQITEAEMADEVICSEILSDCDSAPSSPDLEE
A0A2K5V0Q3_BCL2L2-      AYLETRLADWIHSSGGWLSQITEAEMADEVICSEILSDCDSAPSSPDLEE
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5V0Q3_BCL2L2-      LEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKME
A0A2K5V0Q3_BCL2L2-      -----------FEAGQSVRGQGSPVTKRVSLL---------------RIS
A0A2K5V0Q3_BCL2L2-      LEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKME
A0A2K5V0Q3_BCL2L2-      LEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKME
A0A2K5V0Q3_BCL2L2-      LEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKME
A0A2K5V0Q3_BCL2L2-      LEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKME
A0A2K5V0Q3_BCL2L2-      -----------------------------------------------AMR
A0A2K5V0Q3_BCL2L2-      -----------------------------------------------KME
A0A2K5V0Q3_BCL2L2-      -----------------------------------------------KME
                                                                        : 

A0A2K5V0Q3_BCL2L2-      ADARSIYVGNVDYGATAEELEAHFH---GCGSVNRVTILCDKFSGHP---
A0A2K5V0Q3_BCL2L2-      RANQHLRLGH-------------------CGEAIGRLVLSSRLARAN---
A0A2K5V0Q3_BCL2L2-      ADARSIYVGNVDYGATAEELEAHFH---GCGSVNRVTILCDKFSGHP---
A0A2K5V0Q3_BCL2L2-      ADARSIYVGNVDYGATAEELEAHFH---GCGSVNRVTILCDKFSGHP---
A0A2K5V0Q3_BCL2L2-      ADARSIYVGNVDYGATAEELEAHFH---GCGSVNRVTILCDKFSGHP---
A0A2K5V0Q3_BCL2L2-      ADARSIYVGNVDYGATAEELEAHFH---GCGSVNRVTILCDKFSGHP---
A0A2K5V0Q3_BCL2L2-      AAGDEF---ETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWG
A0A2K5V0Q3_BCL2L2-      ADARSIYVGNVDYGATAEELEAHFH---GCGSVNRVTILCDKFSGHP---
A0A2K5V0Q3_BCL2L2-      ADARSIYVGNVDYGATAEELEAHFH---GCGSVNRVTILCDKFSGHP---
                             :                       ...     :  . :       

A0A2K5V0Q3_BCL2L2-      KGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPG---------
A0A2K5V0Q3_BCL2L2-      HGASYTS-------------------------------------------
A0A2K5V0Q3_BCL2L2-      KGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPG---------
A0A2K5V0Q3_BCL2L2-      KGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPG---------
A0A2K5V0Q3_BCL2L2-      KGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPG---------
A0A2K5V0Q3_BCL2L2-      KGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPG---------
A0A2K5V0Q3_BCL2L2-      RLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW
A0A2K5V0Q3_BCL2L2-      KGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPG---------
A0A2K5V0Q3_BCL2L2-      KGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPG---------
                        .  ::                                             

A0A2K5V0Q3_BCL2L2-      ---ISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRS-----
A0A2K5V0Q3_BCL2L2-      ----------------------------------RARP------------
A0A2K5V0Q3_BCL2L2-      ---ISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRS-----
A0A2K5V0Q3_BCL2L2-      ---ISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRG-----
A0A2K5V0Q3_BCL2L2-      ---ISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRG-----
A0A2K5V0Q3_BCL2L2-      ---ISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRS-----
A0A2K5V0Q3_BCL2L2-      AEFTALYGDGALEEARRLREGNWASVRTVL--------TGAVALGALVTV
A0A2K5V0Q3_BCL2L2-      ---ISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRAGLERH
A0A2K5V0Q3_BCL2L2-      ---ISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRG-----
                                                                          

A0A2K5V0Q3_BCL2L2-      G----------
A0A2K5V0Q3_BCL2L2-      -----------
A0A2K5V0Q3_BCL2L2-      G----------
A0A2K5V0Q3_BCL2L2-      RARATSWYSPY
A0A2K5V0Q3_BCL2L2-      RARATSWFL--
A0A2K5V0Q3_BCL2L2-      G----------
A0A2K5V0Q3_BCL2L2-      GAFFASK----
A0A2K5V0Q3_BCL2L2-      HGIPLTKKSVY
A0A2K5V0Q3_BCL2L2-      RARATSWYSPY
                                   

© 1998-2022Legal notice