Dataset for protein Bcl-w of organism Macaca fascicularis

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5V0Q3_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLRQKGY
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLRQKGY
A0A2K5V0Q3_BCL2L2-      MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGY
A0A2K5V0Q3_BCL2L2-      MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGY
A0A2K5V0Q3_BCL2L2-      MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGY
A0A2K5V0Q3_BCL2L2-      MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGY
A0A2K5V0Q3_BCL2L2-      MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGY
                                                                          

A0A2K5V0Q3_BCL2L2-      VCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQ
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      VCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQ
A0A2K5V0Q3_BCL2L2-      VCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQ
A0A2K5V0Q3_BCL2L2-      VCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQ
A0A2K5V0Q3_BCL2L2-      VCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQ
A0A2K5V0Q3_BCL2L2-      VCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQ
A0A2K5V0Q3_BCL2L2-      VCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQ
                                                                          

A0A2K5V0Q3_BCL2L2-      RFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMV
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      RFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMV
A0A2K5V0Q3_BCL2L2-      RFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMV
A0A2K5V0Q3_BCL2L2-      RFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMV
A0A2K5V0Q3_BCL2L2-      RFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMV
A0A2K5V0Q3_BCL2L2-      RFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMV
A0A2K5V0Q3_BCL2L2-      RFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMV
                                                                          

A0A2K5V0Q3_BCL2L2-      AYLETRLADWIHSSGGW---------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      AYLETRLADWIHSSGGWLSQITEAEMADEVICSEILSDCDSAPSSPDLEE
A0A2K5V0Q3_BCL2L2-      AYLETRLADWIHSSGGWLSQITEAEMADEVICSEILSDCDSAPSSPDLE-
A0A2K5V0Q3_BCL2L2-      AYLETRLADWIHSSGGW--------------------------------E
A0A2K5V0Q3_BCL2L2-      AYLETRLADWIHSSGGWLSQITEAEMADEVICSEILSDCDSAPSSPDLEE
A0A2K5V0Q3_BCL2L2-      AYLETRLADWIHSSGGWLSQITEAEMADEVICSEILSDCDSAPSSPDLEE
A0A2K5V0Q3_BCL2L2-      AYLETRLADWIHSSGGWLSQITEAEMADEVICSEILSDCDSAPSSPDLEE
                                                                          

A0A2K5V0Q3_BCL2L2-      AEFTALYGDGALEEARRLREGNW---------------------------
A0A2K5V0Q3_BCL2L2-      ------------------------------------------MSIEEKME
A0A2K5V0Q3_BCL2L2-      ----------MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKME
A0A2K5V0Q3_BCL2L2-      LEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKME
A0A2K5V0Q3_BCL2L2-      -----------FEAGQSVRGQGSPVTKRVSLL---------------RIS
A0A2K5V0Q3_BCL2L2-      LEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKME
A0A2K5V0Q3_BCL2L2-      LEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKME
A0A2K5V0Q3_BCL2L2-      LEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKME
A0A2K5V0Q3_BCL2L2-      LEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKME
                                                                          

A0A2K5V0Q3_BCL2L2-      ASVRTVLTGAVALGA-----------------------------------
A0A2K5V0Q3_BCL2L2-      ADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYI
A0A2K5V0Q3_BCL2L2-      ADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYI
A0A2K5V0Q3_BCL2L2-      ADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYI
A0A2K5V0Q3_BCL2L2-      RANQHLRLGH----------------CGEAIGRLVLSSRLARANHGASYT
A0A2K5V0Q3_BCL2L2-      ADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYI
A0A2K5V0Q3_BCL2L2-      ADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYI
A0A2K5V0Q3_BCL2L2-      ADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYI
A0A2K5V0Q3_BCL2L2-      ADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYI
                           . :  *                                         

A0A2K5V0Q3_BCL2L2-      -----------LVTVGAFFASK----------------------------
A0A2K5V0Q3_BCL2L2-      EFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRA
A0A2K5V0Q3_BCL2L2-      EFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRA
A0A2K5V0Q3_BCL2L2-      EFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRA
A0A2K5V0Q3_BCL2L2-      S-------------------------------------------------
A0A2K5V0Q3_BCL2L2-      EFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRA
A0A2K5V0Q3_BCL2L2-      EFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRA
A0A2K5V0Q3_BCL2L2-      EFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRA
A0A2K5V0Q3_BCL2L2-      EFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRA
                                                                          

A0A2K5V0Q3_BCL2L2-      -------------------------------------------
A0A2K5V0Q3_BCL2L2-      RTTNYNSSRSRFYSGFNSRPRGRVYRG-----RARATSWYSPY
A0A2K5V0Q3_BCL2L2-      RTTNYNSSRSRFYSGFNSRPRGRVYRAGLERHHGIPLTKKSVY
A0A2K5V0Q3_BCL2L2-      RTTNYNSSRSRFYSGFNSRPRGRVYRS-----G----------
A0A2K5V0Q3_BCL2L2-      ----------------RARP-----------------------
A0A2K5V0Q3_BCL2L2-      RTTNYNSSRSRFYSGFNSRPRGRVYRS-----G----------
A0A2K5V0Q3_BCL2L2-      RTTNYNSSRSRFYSGFNSRPRGRVYRS-----G----------
A0A2K5V0Q3_BCL2L2-      RTTNYNSSRSRFYSGFNSRPRGRVYRG-----RARATSWYSPY
A0A2K5V0Q3_BCL2L2-      RTTNYNSSRSRFYSGFNSRPRGRVYRG-----RARATSWFL--
                                                                   

© 1998-2022Legal notice