Dataset for protein BCL-2-like of organism Lynx canadensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
 ahtgrssqsameiamyyvtattglkkhspsqfsevesnrtgaplgrgnglekdalar erggfs       eaglqlhp
    a mgpmtdae lrvirgprdrmh el   gdpda ppega dqamaaag  f p              d a e ea
      a aa a d akrgh lg  le  c         d ad                                     
             a  ge g         a         a                                        

        90       100       110       120       130       140       150       160
elesdeqpprqradilfp  dvnstplkaf ffapeecepsglm meagvaimqe                  ep  dgy
  a aae fapp  e  e    ga       aa aacaa  ekk  d a  aied                   e     

       170       180       190       200       210       220       230       240
epeppetreavltpksqvnrt      swslrtt avppvtghssalparsvvdspvvksryldlv  aaedaahggqcr
    l kas pgpflaip np      pgpaps    ngee aaa gddllprqmle i  gg eq      rdqfspp 
    e a   m i    n  a      dah ad    ae a        eefi  aa h                 p a 

       250       260       270       280       290       300       310       320
          .  .                       :                           *. : .:        
-v--vtlqvdkfsa-g----yrrflsaykayq---syiefsnktsyktlflrlvvhv-s---t-- hqiavfp---f-c-
aantkaiec qya fsfsqnvp      tklspntrqfdvkdvearqrf patd-e- -  iis   v kflt eavvav
tppsrvsaa  qm aqirle q       d relsve vlvsgqtll n ht ln-e e           i e a tmle
 h  pea    el  e eg            kdcrd   arlf  ag i e    k                a   i i 
             d                                  a                         a   

       330       340       350       360       370       380       390       400
                                      :      :     .::      :                   
eskqer               remsvdisngvysiadgipgakht raqqr  e t crl gpsd   srssipnfwvt-
rppp                 kvvqqccqkvstlvctr ndrtgp  rehd    a  lk snpa    pk wkslnfsw
k ln                 a pgp afh  lfl nf    hee  ed            e n        pelgd qa
   d                    da  d   a           a   a                               

       410       420     
-lsrflvskmt flcryy  lf h 
 elkakim ai aa nt        
   c f c       i         
© 1998-2021Legal notice