Dataset for protein BCL-2-like of organism Lynx canadensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A667GHH0_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEW------DAGDAGAA------
A0A667HK09_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAP------
A0A667GXX5_MCL1-01      -------------MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVA
A0A667I624_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMR
A0A667I624_BCL2L2-      -MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNG
A0A667HQV5_BCL2A1-      ---------MADGEFGYVLTLTRDYMKHVL--------------------
A0A667GW69_BCL2L10      -----------MADALRERRLLTDYLEYCA--------------------
A0A667GXX5_MCL1-02      -------------MFGLKRNAVIGLNLYCGGAGLAAGSGGASSS------
                                                                          

A0A667GHH0_BCL2-01      --------------------------------------------------
A0A667HK09_BCL2L1-      --------------------------------------------------
A0A667GXX5_MCL1-01      VGKEATARREVGGGEAGAVIGGSAGASPPATLAPDARRVARPSPIGAEGP
A0A667I624_BCL2L2-      AAGDEFETRFRRTFS-------DLAAQLHVTPGSAQQRFTQVSDELFQG-
A0A667I624_BCL2L2-      LESEELEP------E-------ELLLEPEPEPEPEEEPPRPRAPPGAPGP
A0A667HQV5_BCL2A1-      --------------------------------------------------
A0A667GW69_BCL2L10      --------------------------------------------------
A0A667GXX5_MCL1-02      --------------------------------------------------
                                                                          

A0A667GHH0_BCL2-01      --------------------------------------------------
A0A667HK09_BCL2L1-      --------------------------------------------------
A0A667GXX5_MCL1-01      DVTATPPKLLFFAATRCASPPEKMEGPAADAIMSP---------------
A0A667I624_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A667I624_BCL2L2-      GPGSG------APGPEEEEEPGLVEGDPGDGAIED---------------
A0A667HQV5_BCL2A1-      --------------------------------------------------
A0A667GW69_BCL2L10      --------------------------------------------------
A0A667GXX5_MCL1-02      --------------------------------------------------
                                                                          

A0A667GHH0_BCL2-01      --------------PGAAPAPGIFSSQPGRT------PAPARTSPPPPPV
A0A667HK09_BCL2L1-      --------------EGTESEMETPSAINGNP------SWHLADSPAVNGA
A0A667GXX5_MCL1-01      ---EEELDGYEPEPLGKRPAVLPLLELVGEASSGPGTDGSLPSTPPPAEE
A0A667I624_BCL2L2-      SSGGWELEAIKARVREMEEEAEKLKELQNEV------EKQMNMSPPPGNA
A0A667I624_BCL2L2-      ----PELEAIKARVREMEEEAEKLKELQNEV------EKQMNMSPPPGNA
A0A667HQV5_BCL2A1-      --------------------------------------------------
A0A667GW69_BCL2L10      --------------------------------------------------
A0A667GXX5_MCL1-02      --------------------------------------------------
                                                                          

A0A667GHH0_BCL2-01      APAAAAGPALSPVP-PVVH----------------------------LTL
A0A667HK09_BCL2L1-      TGHSSSLDAREVIPMAAVK----------------------------QAL
A0A667GXX5_MCL1-01      E------EDELFRQSLEIISRYLREQATGAKDAKPLGGSGAASRKALETL
A0A667I624_BCL2L2-      GPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCD
A0A667I624_BCL2L2-      GPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCD
A0A667HQV5_BCL2A1-      ----------------------------------QGPQPGSHPSRVSQVL
A0A667GW69_BCL2L10      --------------------------------RDPGSPARTPSTPEAAVL
A0A667GXX5_MCL1-02      ---------------------GGRLVATGAKDAKPLGGSGAASRKALETL
                                                                          

A0A667GHH0_BCL2-01      RQAGDDFSRRYR------RDFAEMSSQLHLTPFTARGRF-ATVVEELFRD
A0A667HK09_BCL2L1-      REAGDEFELRYR------RAFSDLTSQLHITPGTAYQSF-EQVVNELFRD
A0A667GXX5_MCL1-01      RRVGDGVQRNHE------TAFQGMLRKLDIKNEDDVKSL-SRVMVHVFSD
A0A667I624_BCL2L2-      KFSG------HP------KGFA----YIEFSDKESVRTS-LALDESLFR-
A0A667I624_BCL2L2-      KFSG------HP------KGFA----YIEFSDKESVRTS-LALDESLFR-
A0A667HQV5_BCL2A1-      QDMAFSVQGEVE------KKLKPCLDKFHVVSVDTARTIFHQVMEKEFED
A0A667GW69_BCL2L10      RYLAAQIRQRHQRFLSAYRGYRGNRVELVARLEQDLLSN-PQTL------
A0A667GXX5_MCL1-02      RRVGDGVQRNHE------TAFQGMLRKLDIKNEDDVKSL-SRVMVHVFSD
                        .  .                       :                      

A0A667GHH0_BCL2-01      GV-NWGRIVAFFEFGGVMCVESVN-----------------REMSPLVDN
A0A667HK09_BCL2L1-      GV-NWGRIVAFFSFGGALCVESVD-----------------KEMQVLVSR
A0A667GXX5_MCL1-01      GVTNWGRIVTLISFGAFVAKHLKS-----------------INQESCIEP
A0A667I624_BCL2L2-      -----GRQIKVIP-------------------------------KRTNRP
A0A667I624_BCL2L2-      -----GRQIKVIP-------------------------------KRTNRP
A0A667HQV5_BCL2A1-      GIINWGRIVTIFAFEGILIKKLLQER---------------IVPDADAFK
A0A667GW69_BCL2L10      ---SWGHVVALLTFAGTLLERPPPGTYLNLTPAQQQELEWEANVGQDCQH
A0A667GXX5_MCL1-02      GVTNWGRIVTLISFGAFVAKHLKS-----------------INQESCIEP
                             *. : .:                                      

A0A667GHH0_BCL2-01      IALWMTEYLNRHLHTWIQDNGGWD-AFVELYGPSM-------QPLFDFSW
A0A667HK09_BCL2L1-      IATWMATYLNDHLEPWIQENGGWD-TFVELYGNNAAAESRKGQERFN---
A0A667GXX5_MCL1-01      LAESITDVLVRTKRDWLVKQRGWD-GFVEFFHVED---LEGGIRNVLLAF
A0A667I624_BCL2L2-      GISTTDRGFPRAR--YRARTTNYN-SSRSRF------------------Y
A0A667I624_BCL2L2-      GISTTDRGFPRAR--YRARTTNYN-SSRSRF------------------Y
A0A667HQV5_BCL2A1-      VSYFVAEFITKHTGEWIRQNGGWENGFVRKFE----------PKSGWLTF
A0A667GW69_BCL2L10      LVALLCNRLTGRHRAWLEAHDGWD-GFCLFFS-PM---LPSSWRRLLVQA
A0A667GXX5_MCL1-02      LAESITDVLVRTKRDWLVKQRGWD-GFVEFFHVED---LEGGIRNVLLAF
                                :      :     .::      :                   

A0A667GHH0_BCL2-01      LSLKALLSLALVGACITLGAYLGHK
A0A667HK09_BCL2L1-      ---RWFLTGMTVAGVVLLGSLFSRK
A0A667GXX5_MCL1-01      AGVAGVGAGLAYLIR----------
A0A667I624_BCL2L2-      SGFNSRPRGRVYRGRARATSWYSPY
A0A667I624_BCL2L2-      SGFNSRPRGRVYRGRARATSWYSPY
A0A667HQV5_BCL2A1-      LEVTGKICKVLSLLKNYY-------
A0A667GW69_BCL2L10      LLSCFTVMTLIYFWRRLL-------
A0A667GXX5_MCL1-02      AGVAGVGAGLAYLIR----------
                                                 

© 1998-2020Legal notice