Dataset for protein BCL-2-like of organism Lynx canadensis

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A667GHH0_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Lynx canadensis GN=BCL-2 (length=231 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPGAAPAPGIFSSQPGRTPAPARTSPPPPPVAPAAAAGPALSP
VPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSP
LVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A667GW69_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Lynx canadensis GN=BCL2L10 (length=190 residues).
MADALRERRLLTDYLEYCARDPGSPARTPSTPEAAVLRYLAAQIRQRHQRFLSAYRGYRGNRVELVARLEQDLLSNPQTL
SWGHVVALLTFAGTLLERPPPGTYLNLTPAQQQELEWEANVGQDCQHLVALLCNRLTGRHRAWLEAHDGWDGFCLFFSPM
LPSSWRRLLVQALLSCFTVMTLIYFWRRLL
>gnl|bcl2dbpro|A0A667GXX5_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Lynx canadensis GN=MCL-1 (length=197 residues).
MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A667GXX5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Lynx canadensis GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVAVGKEATARREVGGGEAGAVIGGSAGASPPATLAPDARRVARPS
PIGAEGPDVTATPPKLLFFAATRCASPPEKMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPGTDGSL
PSTPPPAEEEEDELFRQSLEIISRYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A667HK09_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Lynx canadensis GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A667HQV5_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Lynx canadensis GN=BCL2A1 (length=174 residues).
MADGEFGYVLTLTRDYMKHVLQGPQPGSHPSRVSQVLQDMAFSVQGEVEKKLKPCLDKFHVVSVDTARTIFHQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLQERIVPDADAFKVSYFVAEFITKHTGEWIRQNGGWENGFVRKFEPKSGWLTFLEVT
GKICKVLSLLKNYY
>gnl|bcl2dbpro|A0A667I624_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Lynx canadensis GN=BCL2L2 (length=333 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
RGRARATSWYSPY
>gnl|bcl2dbpro|A0A667I624_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Lynx canadensis GN=BCL2L2 (length=305 residues).
MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPEELLLEPEPEPEPEEEPPRPRAP
PGAPGPGPGSGAPGPEEEEEPGLVEGDPGDGAIEDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIM
SIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQ
IKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
© 1998-2020Legal notice