Dataset for protein Mcl-1 of organism Loxodonta africana

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                         **:**.*
-------------------------------------------------------------------------GAqGPsV
mfgfkrnaviglnlycggaglgaggcatppggrlpapgkeatarqevgggdagasppaavapdgrrvvrpapi  e  d 

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
** **** :**.   :*** * :* .*:****.****. *: *.******.:* * ******* *** *:**** * ***
TAtPARPtlFAstrrtSPPvEmnAsvAeAIMSpEEELgrYkpEtLGKRPAvlPrLvLVGEASNgPGThGsLPSTqPpAEE
  i    mf  pipca   e ae la d    a    dg el p      af l g       c   d a    p l   

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***:** ***:** ***:*** **.: . : *        : .* ********* **. ****** *:***:****** .
EEDkLYrQSLeIIsRYLqEQAtGAtqtrqmgG--------vrtLrRVADGVQRNhETvsQGMLRKpDiKNEnDVKSLSrv
   e  p   d  f   h   i  kdgkple sgaasrkalen p         e  af      l f   d      ga

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*.****.***:****** *******.**: *:***:     **.*****:* **  * *.** **:***.**:* :*. *
MvHVFSgGITnWGRIVT-ISFGAFVvKHlkSvNQEsr----AEsITDVLvR-KRywLvKrRGwDGlVEFvHVkDpqGgiR
 a    d   k      l       a  fg i   aaiepl  c     l t  dc d q  g  f   f  e le dc 

       330       340 
....:....|....:....|.
** *****             
NVqLAFAG-------------
  l     vagvgaglaylir
© 1998-2020Legal notice