Dataset for protein Mcl-1 of organism Loxodonta africana

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|G3T756_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Loxodonta africana GN=MCL-1 (length=341 residues).
MFGFKRNAVIGLNLYCGGAGLGAGGCATPPGGRLPAPGKEATARQEVGGGDAGASPPAAVAPDGRRVVRPAPIGAEGPDV
TAIPARPTFFAPTRRASPPVEMEALAADAIMSPEEELDGYEPEPLGKRPAVFPRLGLVGEASNGPGTDGSLPSTPPLAEE
EEDELYRQSLEIISRYLQEQATGAKDTKPMGGSGAASRKALETLRRVADGVQRNHETAFQGMLRKLDIKNEDDVKSLSRV
MAHVFSDGITNWGRIVTLISFGAFVAKHLKSVNQESRIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIR
NVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|G3TVG9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Loxodonta africana GN=MCL-1 (length=241 residues).
GAQGPSVTATPARPMLFASIPCTSPPEEANASVAEAIMSAEEELGRYKLETLGKRPAALPLLVLVGEASNCPGTHGALPS
TQPPAEEEEDKLYPQSLDIIFRYLHEQAIGATQGRQLEGVRNLPRVADGVQRNEETVSQGMLRKPDFKNENDVKSLSGAM
VHVFSGGITKWGRIVTISFGAFVVKHFGSINQEAAAECITDVLLRKRYCLDKRRGGDGLVEFVHVKDPQGDCRNVQLAFA
G
© 1998-2020Legal notice