Dataset for protein Mcl-1 of organism Loxodonta africana

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G3T756_MCL1-01      MFGFKRNAVIGLNLYCGGAGLGAGGCATPPGGRLPAPGKEATARQEVGGGDAGASPPAAV
G3TVG9_MCL1-01      ------------------------------------------------------------
                                                                                

G3T756_MCL1-01      APDGRRVVRPAPIGAEGPDVTAIPARPTFFAPTRRASPPVEMEALAADAIMSPEEELDGY
G3TVG9_MCL1-01      -------------GAQGPSVTATPARPMLFASIPCTSPPEEANASVAEAIMSAEEELGRY
                                 **:**.*** **** :**.   :*** * :* .*:****.****. *

G3T756_MCL1-01      EPEPLGKRPAVFPRLGLVGEASNGPGTDGSLPSTPPLAEEEEDELYRQSLEIISRYLQEQ
G3TVG9_MCL1-01      KLETLGKRPAALPLLVLVGEASNCPGTHGALPSTQPPAEEEEDKLYPQSLDIIFRYLHEQ
                    : *.******.:* * ******* *** *:**** * ******:** ***:** ***:**

G3T756_MCL1-01      ATGAKDTKPMGGSGAASRKALETLRRVADGVQRNHETAFQGMLRKLDIKNEDDVKSLSRV
G3TVG9_MCL1-01      AIGATQGRQLEG--------VRNLPRVADGVQRNEETVSQGMLRKPDFKNENDVKSLSGA
                    * **.: . : *        : .* ********* **. ****** *:***:****** .

G3T756_MCL1-01      MAHVFSDGITNWGRIVTLISFGAFVAKHLKSVNQESRIEPLAESITDVLVRTKRDWLVKQ
G3TVG9_MCL1-01      MVHVFSGGITKWGRIVT-ISFGAFVVKHFGSINQEAA----AECITDVLLR-KRYCLDKR
                    *.****.***:****** *******.**: *:***:     **.*****:* **  * *.

G3T756_MCL1-01      RGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
G3TVG9_MCL1-01      RGGDGLVEFVHVKDPQGDCRNVQLAFAG-------------
                    ** **:***.**:* :*. *** *****             

© 1998-2020Legal notice