Dataset for protein BCL-2-like of organism Leptobrachium leishanense

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                  .  :                                                          
-------mahprragydhrdivvkyihykls--------qrgyew-----------------------------------
mctctlm------mnggskpllqrfvcmrrkpgtllhsl------ipgpvlppdhfnkvykrqpnavlrlshqcreraaf
       prls wsepaqhnw knrfrkgah        redlvs                                   
       egg  a dl n gv eglaad  g           ft                                    
                 g  ad                   g                                    
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------edgrqqvsvdlqdasaannnhsdgdevsaspg---
taaerdaarclslcghslarpatpprlklvglqfpalsaqiiikm-------------------------tcctps-imq
                                              a kva ama rekevqedaagy  npvldgs   
                                                                        rgaea   
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                        .                                                       
---------dplgprhdtplnaaastsnnasqnnaptalldnapa-----------------------------------
asnaekker----------scsvqpsmrspgg----r--------qenpmqpseaereegpestcqaqkcfletsealee
         llrfswyqpqhseml pgtfre-qsgr-vtrhtgst                                   
         edh dtifamf  lh neae  elpcaetsg scq                                    
                   e  ic a  a   ee    g                                         
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--aqrssasaastvpspqgvlnvtqgnsnvdsganqlvdgdgedalvrp-------------------------------
rq-----------------------------------------------edpqcrqdelflysrlllltffreyaggpdp
  gee pedstd cq l nf esseaeqeeedrddkkmea vpgpspp                                
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                              .          :      : :        :  *   :* .*  ****:.:
----------vpqavlqtlsragdefsrlyq--------qdfrqisgllhltpstvrprfaaVveelFhdG-vNWGRiva
gpvraliqla---------l--arytelrnrgrrclcrpaalsntltqisiqrpeayqklse tglv sg it    vat
          msnta  a -dv-h mke fk        rp qgmtsr cveqg hlas eq psg  r  ai       
          e e        lse  id  h         c hel nk     e d     l afa  q           
                                           d         a              n           
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:: * . :.       :   :  :   .. :*     .*:  : .*                             :    
ffeFggvmcvesvnremsplvdsivgwmteyLnrhlqnWiqeqggW--fv---------------is--------lltlv
lis taalarhlqskkledslptladnvvtf tttkrd mmtnqs eg--elygvsayesgrrswe-nwaslktwitnia
  v   lv k  khlg nrcivr qqgfar  mns es f shk  ds lrfflsgvwqtslptv-t   rfgrvfplvq
      f  a    i  a   fq  e   d  eiq  e   q e  na  a  hnerrppfikqrvg         mggl
                      p         d                    ddddiaead cqna         keff
                                                         a      la          faae
                                                                            e   

       490       500       510     
....:....|....:....|....:....|....:
                                   
tlaglitsllymar---------------------
yvhaigaciaislywshrksqstysqrrtrilths
siqvvvrvttrlitrpwkgnecnwikgaqh     
iggsstplssqh sqg                   
gf f mlekqlg ql                    
a    aeagf f mk                    
           d                       
© 1998-2022Legal notice