Dataset for protein BCL-2-like of organism Leptobrachium leishanense

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A8C5MT36_BCL2-04 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Leptobrachium leishanense GN=BCL-2 (length=291 residues).
MAHPRRAGYDHRDIVVKYIHYKLSQRGYEWEDGRQQVSVDLQDASAANNNHSDGDEVSASPGDPLGPRHDTPLNAAASTS
NNASQNNAPTALLDNAPAAQRSSASAASTVPSPQGVLNVTQGNSNVDSGANQLVDGDGEDALVRPVPQAVLQTLSRAGDE
FSRLYQQDFRQISGLLHLTPSTVRPRFAAVVEELFHDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIVGWMTEYLNR
HLQNWIQEQGGWCWASLELVQTGHASTPCKLQHLTWPWRGSQSNYSQGRTH
>gnl|bcl2dbpro|A0A8C5MT36_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Leptobrachium leishanense GN=BCL-2 (length=296 residues).
MAHPRRAGYDHRDIVVKYIHYKLSQRGYEWEDGRQQVSVDLQDASAANNNHSDGDEVSASPGDPLGPRHDTPLNAAASTS
NNASQNNAPTALLDNAPAAQRSSASAASTVPSPQGVLNVTQGNSNVDSGANQLVDGDGEDALVRPVPQAVLQTLSRAGDE
FSRLYQQDFRQISGLLHLTPSTVRPRFAAVVEELFHDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIVGWMTEYLNR
HLQNWIQEQGGWESFVELYDSSVRPPFDPSWISIKTILSLAVVGACITIGAYLGHK
>gnl|bcl2dbpro|A0A8C5MT36_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Leptobrachium leishanense GN=BCL-2 (length=273 residues).
MAHPRRAGYDHRDIVVKYIHYKLSQRGYEWEDGRQQVSVDLQDASAANNNHSDGDEVSASPGDPLGPRHDTPLNAAASTS
NNASQNNAPTALLDNAPAAQRSSASAASTVPSPQGVLNVTQGNSNVDSGANQLVDGDGEDALVRPVPQAVLQTLSRAGDE
FSRLYQQDFRQISGLLHLTPSTVRPRFAAVVEELFHDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIVGWMTEYLNR
HLQNWIQEQGGWVSFFNLFYIHFLVEASFIDAQ
>gnl|bcl2dbpro|A0A8C5MT36_BCL2-03 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Leptobrachium leishanense GN=BCL-2 (length=295 residues).
MAHPRRAGYDHRDIVVKYIHYKLSQRGYEWEDGRQQVSVDLQDASAANNNHSDGDEVSASPGDPLGPRHDTPLNAAASTS
NNASQNNAPTALLDNAPAAQRSSASAASTVPSPQGVLNVTQGNSNVDSGANQLVDGDGEDALVRPVPQAVLQTLSRAGDE
FSRLYQQDFRQISGLLHLTPSTVRPRFAAVVEELFHDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIVGWMTEYLNR
HLQNWIQEQGGWLNTLPEIETLQSLIRETQRSLRQSHRKNECTWIKRAQRILTHS
>gnl|bcl2dbpro|A0A8C5PJB3_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Leptobrachium leishanense GN=BCL2L2 (length=191 residues).
PGLPRASDLGSRPLVEDFVRYKLHQRGLVSEPVGAPSCALHSAMRAAGDEFEDRFRQAFSEISTQIHVTPGTAYARFAEV
AGGLFQGGVNWGRVVAFFVFGAALCAESVNKEMARLLPQIQEWMVTYLETHLRDWMQSNGGWNGFLALYGDGAIEEARRQ
REGNWASLKTVLTGAVALGALMTVGALFASK
>gnl|bcl2dbpro|A0A8C5PJK5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Leptobrachium leishanense GN=MCL-1 (length=476 residues).
MCTCTLMERGSRWAGPDQRGWLKRRAAMRAKPGTLLHSLREGYGWIPGPVLPPDHFNKVYKRQPNAVLRLSHQCRERAAF
TAAERDAARCLSLCGHSLARPATPPRLKLVGLQFPALSAQIIIKMEAGKVAVAMALREKEVQEDAAGYGDTCRAPESIMQ
ASNAEKKEREDHGDTYQAQENSMQSSEAEREGEEGPETTRDTCQTQENPMQPSEAEREEGPESTCQAQKCFLETSEALEE
RQGEESPEDSTDTCQSLQNFLESSEAEQEEEDRDDKKMEADVPGPSPPPEDPQCRQDELFLYSRLLLLTFFREYAGGPDP
GPVRALIQLAMPNTALQTLLRVARETIERNHACFQNTLNRLCIERPEHLQKLSLVTFALFSDGAINWGRIATLFSFTALV
ARHLKNLGMNDSIFTLADGVARFLTITKRSWFQEHQGWDGFVEFFLVSRWQTGIRIALLALAIFAGIATSLLYLIM
>gnl|bcl2dbpro|A0A8C5QRL7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Leptobrachium leishanense GN=MCL-1 (length=200 residues).
MNGAGHFVVAGLFCDGRGTCCLSGALLRFSWIFPMFCSICPPSRFPGGLSCRRVSLRLAHYMKLLYKGRRCLCRPAPLHG
MLTKLSIQQAEDLQKLSEVPSLVFNDGITNWGRIVTLISFGAFLAKHLQSIKLEDCIVPLADNFTDYLMTSKREWIMQQK
SWDGFVEFFHVEDYESGLRTVLMTFAGVAGIGASLAYMIR
>gnl|bcl2dbpro|A0A8C5WFB8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Leptobrachium leishanense GN=BCL2L1 (length=208 residues).
MEGGNKNLVQNFVCKKLSQRDFTWNCCTDSHSEVLSNGTSPGEQPAARAGGHSGSTESEAVLQALLDASEEFELRYQRAF
SDLTSQLHITPETAYQSFEQVVGELFRDGTNWGRIVAFFSFGGALCVESVHKEMEDLLPRIVQWMTTYLDNQLEDWIQTN
EGWEAFVRLYGNDAAASSRKSQERFGRWLLTGVTLAGIILLISYMARR
© 1998-2022Legal notice