Dataset for protein BCL-2-like of organism Leptobrachium leishanense

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5PJB3_BCL2L2-      -------PGLPRASDLGSRPLVEDFVRYKLH--------QRGLVS-----
A0A8C5QRL7_MCL1-01      -------------MNGAGHFVVAGLFCDGRG-------------------
A0A8C5WFB8_BCL2L1-      -------------MEGGNKNLVQNFVCKKLS--------QRDFTW-----
A0A8C5PJK5_MCL1-01      MCTCTLMERGSRWAGPDQRGWLKRRAAMRAKPGTLLHSLREGYGWIPGPV
A0A8C5MT36_BCL2-02      -------MAHPRRAGYDHRDIVVKYIHYKLS--------QRGYEW-----
A0A8C5MT36_BCL2-03      -------MAHPRRAGYDHRDIVVKYIHYKLS--------QRGYEW-----
A0A8C5MT36_BCL2-04      -------MAHPRRAGYDHRDIVVKYIHYKLS--------QRGYEW-----
A0A8C5MT36_BCL2-01      -------MAHPRRAGYDHRDIVVKYIHYKLS--------QRGYEW-----
                                          .  :                            

A0A8C5PJB3_BCL2L2-      --------------------------------------------------
A0A8C5QRL7_MCL1-01      --------------------------------------------------
A0A8C5WFB8_BCL2L1-      --------------------------------------------------
A0A8C5PJK5_MCL1-01      LPPDHFNKVYKRQPNAVLRLSHQCRERAAFTAAERDAARCLSLCGHSLAR
A0A8C5MT36_BCL2-02      --------------------------------------------------
A0A8C5MT36_BCL2-03      --------------------------------------------------
A0A8C5MT36_BCL2-04      --------------------------------------------------
A0A8C5MT36_BCL2-01      --------------------------------------------------
                                                                          

A0A8C5PJB3_BCL2L2-      --------------------------------------------------
A0A8C5QRL7_MCL1-01      --------------------------------------------------
A0A8C5WFB8_BCL2L1-      --------------------------------------------------
A0A8C5PJK5_MCL1-01      PATPPRLKLVGLQFPALSAQIIIKMEAGKVAVAMALREKEVQEDAAGYGD
A0A8C5MT36_BCL2-02      -------------------------EDGRQQVSVDLQDASAANNNHSDGD
A0A8C5MT36_BCL2-03      -------------------------EDGRQQVSVDLQDASAANNNHSDGD
A0A8C5MT36_BCL2-04      -------------------------EDGRQQVSVDLQDASAANNNHSDGD
A0A8C5MT36_BCL2-01      -------------------------EDGRQQVSVDLQDASAANNNHSDGD
                                                                          

A0A8C5PJB3_BCL2L2-      EPVGAP-----------------------SCALHSAMRAAG---------
A0A8C5QRL7_MCL1-01      TCCLSGA------------LLRFSWIFPMFCSICPPSRFPGGLSCRRVS-
A0A8C5WFB8_BCL2L1-      NCCTDS-----------------------HSEVLSNGTSPGEQPAARAGG
A0A8C5PJK5_MCL1-01      TCRAPESIMQASNAEKKEREDHGDTYQAQENSMQSSEAEREGEEGPETTR
A0A8C5MT36_BCL2-02      EVSASPG------------DPLGPRHDTPLNAAASTSNNASQNNAPTALL
A0A8C5MT36_BCL2-03      EVSASPG------------DPLGPRHDTPLNAAASTSNNASQNNAPTALL
A0A8C5MT36_BCL2-04      EVSASPG------------DPLGPRHDTPLNAAASTSNNASQNNAPTALL
A0A8C5MT36_BCL2-01      EVSASPG------------DPLGPRHDTPLNAAASTSNNASQNNAPTALL
                                                          .               

A0A8C5PJB3_BCL2L2-      --------------------------------------------------
A0A8C5QRL7_MCL1-01      --------------------------------------------------
A0A8C5WFB8_BCL2L1-      HSGST---------------------------------------------
A0A8C5PJK5_MCL1-01      DTCQTQENPMQPSEAEREEGPESTCQAQKCFLETSEALEERQGEESPEDS
A0A8C5MT36_BCL2-02      DNAPA-------------------------------------AQRSSASA
A0A8C5MT36_BCL2-03      DNAPA-------------------------------------AQRSSASA
A0A8C5MT36_BCL2-04      DNAPA-------------------------------------AQRSSASA
A0A8C5MT36_BCL2-01      DNAPA-------------------------------------AQRSSASA
                                                                          

A0A8C5PJB3_BCL2L2-      --------------------------------------------------
A0A8C5QRL7_MCL1-01      --------------------------------------------------
A0A8C5WFB8_BCL2L1-      --------------------------------------------------
A0A8C5PJK5_MCL1-01      TDTCQSLQNFLESSEAEQEEEDRDDKKMEADVPGPSPPPEDPQCRQDELF
A0A8C5MT36_BCL2-02      ASTVPSPQGVLNVTQGNSNVDSGANQLVDGDGEDALVRP-----------
A0A8C5MT36_BCL2-03      ASTVPSPQGVLNVTQGNSNVDSGANQLVDGDGEDALVRP-----------
A0A8C5MT36_BCL2-04      ASTVPSPQGVLNVTQGNSNVDSGANQLVDGDGEDALVRP-----------
A0A8C5MT36_BCL2-01      ASTVPSPQGVLNVTQGNSNVDSGANQLVDGDGEDALVRP-----------
                                                                          

A0A8C5PJB3_BCL2L2-      -------------------------------------------DEFEDRF
A0A8C5QRL7_MCL1-01      ---------------------------------------LRLAHYMKLLY
A0A8C5WFB8_BCL2L1-      ------------------------------ESEAVLQALLDASEEFELRY
A0A8C5PJK5_MCL1-01      LYSRLLLLTFFREYAGGPDPGPVRALIQLAMPNTALQTLLRVARETIERN
A0A8C5MT36_BCL2-02      ------------------------------VPQAVLQTLSRAGDEFSRLY
A0A8C5MT36_BCL2-03      ------------------------------VPQAVLQTLSRAGDEFSRLY
A0A8C5MT36_BCL2-04      ------------------------------VPQAVLQTLSRAGDEFSRLY
A0A8C5MT36_BCL2-01      ------------------------------VPQAVLQTLSRAGDEFSRLY
                                                                          

A0A8C5PJB3_BCL2L2-      R--------QAFSEISTQIHVTPGTAYARFAEVAGGLFQGG-VNWGRVVA
A0A8C5QRL7_MCL1-01      KGRRCLCRPAPLHGMLTKLSIQQAEDLQKLSEVPSLVFNDGITNWGRIVT
A0A8C5WFB8_BCL2L1-      Q--------RAFSDLTSQLHITPETAYQSFEQVVGELFRDG-TNWGRIVA
A0A8C5PJK5_MCL1-01      H--------ACFQNTLNRLCIERPEHLQKLSLVTFALFSDGAINWGRIAT
A0A8C5MT36_BCL2-02      Q--------QDFRQISGLLHLTPSTVRPRFAAVVEELFHDG-VNWGRIVA
A0A8C5MT36_BCL2-03      Q--------QDFRQISGLLHLTPSTVRPRFAAVVEELFHDG-VNWGRIVA
A0A8C5MT36_BCL2-04      Q--------QDFRQISGLLHLTPSTVRPRFAAVVEELFHDG-VNWGRIVA
A0A8C5MT36_BCL2-01      Q--------QDFRQISGLLHLTPSTVRPRFAAVVEELFHDG-VNWGRIVA
                        .          :      : :        :  *   :* .*  ****:.:

A0A8C5PJB3_BCL2L2-      FFVFGAALCAESVNKEMARLLPQIQEWMVTYLETHLRDWMQSNGGWNGFL
A0A8C5QRL7_MCL1-01      LISFGAFLAKHLQSIKLEDCIVPLADNFTDYLMTSKREWIMQQKSWDGFV
A0A8C5WFB8_BCL2L1-      FFSFGGALCVESVHKEMEDLLPRIVQWMTTYLDNQLEDWIQTNEGWEAFV
A0A8C5PJK5_MCL1-01      LFSFTALVARHLKNLGMNDSIFTLADGVARFLTITKRSWFQEHQGWDGFV
A0A8C5MT36_BCL2-02      FFEFGGVMCVESVNREMSPLVDSIVGWMTEYLNRHLQNWIQEQGGW----
A0A8C5MT36_BCL2-03      FFEFGGVMCVESVNREMSPLVDSIVGWMTEYLNRHLQNWIQEQGGW----
A0A8C5MT36_BCL2-04      FFEFGGVMCVESVNREMSPLVDSIVGWMTEYLNRHLQNWIQEQGGW----
A0A8C5MT36_BCL2-01      FFEFGGVMCVESVNREMSPLVDSIVGWMTEYLNRHLQNWIQEQGGWESFV
                        :: * . :.       :   :  :   .. :*     .*:  : .*    

A0A8C5PJB3_BCL2L2-      ALYGDGAIEEARRQREGNWASLKTVLTGAVALGALMTVGALFASK-----
A0A8C5QRL7_MCL1-01      EFFHVEDYESGLRTV----------LMTFAGVAGIGASLAYMIR------
A0A8C5WFB8_BCL2L1-      RLYGNDAAASSRKSQE----RFGRWLLTGVTLAGIILLISYMARR-----
A0A8C5PJK5_MCL1-01      EFFLVSRWQTGIR--IA--------LLALAIFAGIATSLLYLIM------
A0A8C5MT36_BCL2-02      ---------------VS--------FFNLFYIHFLVEASFIDAQ------
A0A8C5MT36_BCL2-03      --------------LNT--------LPEIETLQSLIRETQRSLRQSHRKN
A0A8C5MT36_BCL2-04      -------------CWAS--------LELVQTGHASTPCKLQHLTWPWRGS
A0A8C5MT36_BCL2-01      ELYDSSVRPPFDPSWIS--------IKTILSLAVVGACITIGAYLGHK--
                                                 :                        

A0A8C5PJB3_BCL2L2-      ---------------
A0A8C5QRL7_MCL1-01      ---------------
A0A8C5WFB8_BCL2L1-      ---------------
A0A8C5PJK5_MCL1-01      ---------------
A0A8C5MT36_BCL2-02      ---------------
A0A8C5MT36_BCL2-03      ECTWIKRAQRILTHS
A0A8C5MT36_BCL2-04      QSNYSQGRTH-----
A0A8C5MT36_BCL2-01      ---------------
                                       

© 1998-2022Legal notice