Dataset for protein Bcl-2 of organism Leptobrachium leishanense

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MAHPRRAGYDHRDIVVKYIHYKLSQRGYEWEDGRQQVSVDLQDASAANNNHSDGDEVSASPGDPLGPRHDTPLNAAASTS
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
NNASQNNAPTALLDNAPAAQRSSASAASTVPSPQGVLNVTQGNSNVDSGANQLVDGDGEDALVRPVPQAVLQTLSRAGDE
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
FSRLYQQDFRQISGLLHLTPSTVRPRFAAVVEELFHDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIVGWMTEYLNR
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
************                    ::  :                                    
HLQNWIQEQGGW------------------wvslptiqtlhvlvrcttisly--hr-----------------
            esfvelydssvrppfdps-ntiknvlyiqsvtpesqrhatws--ksqstysqrrtrilths
                             cli ffllfsgafsieaklqg rqpwkgnecnwikgaqh     
                               a  ee e   a ga if d qlg                   
© 1998-2022Legal notice