Dataset for protein Bcl-2 of organism Leptobrachium leishanense

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5MT36_BCL2-02      MAHPRRAGYDHRDIVVKYIHYKLSQRGYEWEDGRQQVSVDLQDASAANNN
A0A8C5MT36_BCL2-03      MAHPRRAGYDHRDIVVKYIHYKLSQRGYEWEDGRQQVSVDLQDASAANNN
A0A8C5MT36_BCL2-04      MAHPRRAGYDHRDIVVKYIHYKLSQRGYEWEDGRQQVSVDLQDASAANNN
A0A8C5MT36_BCL2-01      MAHPRRAGYDHRDIVVKYIHYKLSQRGYEWEDGRQQVSVDLQDASAANNN
                        **************************************************

A0A8C5MT36_BCL2-02      HSDGDEVSASPGDPLGPRHDTPLNAAASTSNNASQNNAPTALLDNAPAAQ
A0A8C5MT36_BCL2-03      HSDGDEVSASPGDPLGPRHDTPLNAAASTSNNASQNNAPTALLDNAPAAQ
A0A8C5MT36_BCL2-04      HSDGDEVSASPGDPLGPRHDTPLNAAASTSNNASQNNAPTALLDNAPAAQ
A0A8C5MT36_BCL2-01      HSDGDEVSASPGDPLGPRHDTPLNAAASTSNNASQNNAPTALLDNAPAAQ
                        **************************************************

A0A8C5MT36_BCL2-02      RSSASAASTVPSPQGVLNVTQGNSNVDSGANQLVDGDGEDALVRPVPQAV
A0A8C5MT36_BCL2-03      RSSASAASTVPSPQGVLNVTQGNSNVDSGANQLVDGDGEDALVRPVPQAV
A0A8C5MT36_BCL2-04      RSSASAASTVPSPQGVLNVTQGNSNVDSGANQLVDGDGEDALVRPVPQAV
A0A8C5MT36_BCL2-01      RSSASAASTVPSPQGVLNVTQGNSNVDSGANQLVDGDGEDALVRPVPQAV
                        **************************************************

A0A8C5MT36_BCL2-02      LQTLSRAGDEFSRLYQQDFRQISGLLHLTPSTVRPRFAAVVEELFHDGVN
A0A8C5MT36_BCL2-03      LQTLSRAGDEFSRLYQQDFRQISGLLHLTPSTVRPRFAAVVEELFHDGVN
A0A8C5MT36_BCL2-04      LQTLSRAGDEFSRLYQQDFRQISGLLHLTPSTVRPRFAAVVEELFHDGVN
A0A8C5MT36_BCL2-01      LQTLSRAGDEFSRLYQQDFRQISGLLHLTPSTVRPRFAAVVEELFHDGVN
                        **************************************************

A0A8C5MT36_BCL2-02      WGRIVAFFEFGGVMCVESVNREMSPLVDSIVGWMTEYLNRHLQNWIQEQG
A0A8C5MT36_BCL2-03      WGRIVAFFEFGGVMCVESVNREMSPLVDSIVGWMTEYLNRHLQNWIQEQG
A0A8C5MT36_BCL2-04      WGRIVAFFEFGGVMCVESVNREMSPLVDSIVGWMTEYLNRHLQNWIQEQG
A0A8C5MT36_BCL2-01      WGRIVAFFEFGGVMCVESVNREMSPLVDSIVGWMTEYLNRHLQNWIQEQG
                        **************************************************

A0A8C5MT36_BCL2-02      GW-------------------VSFFNLFYIHFLVEASFIDAQ--------
A0A8C5MT36_BCL2-03      GW------------------LNTLPEIETLQSLIRETQRSLRQSHRKNEC
A0A8C5MT36_BCL2-04      GW-----------------CWASLELVQTGHASTPCKLQHLTWPWRGSQS
A0A8C5MT36_BCL2-01      GWESFVELYDSSVRPPFDPSWISIKTILSLAVVGACITIGAYLGHK----
                        **                    ::  :                       

A0A8C5MT36_BCL2-02      -------------
A0A8C5MT36_BCL2-03      TWIKRAQRILTHS
A0A8C5MT36_BCL2-04      NYSQGRTH-----
A0A8C5MT36_BCL2-01      -------------
                                     

© 1998-2022Legal notice