Dataset for protein Bcl-2 of organism Leptobrachium leishanense

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C5MT36_BCL2-04 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Leptobrachium leishanense GN=BCL-2 (length=291 residues).
MAHPRRAGYDHRDIVVKYIHYKLSQRGYEWEDGRQQVSVDLQDASAANNNHSDGDEVSASPGDPLGPRHDTPLNAAASTS
NNASQNNAPTALLDNAPAAQRSSASAASTVPSPQGVLNVTQGNSNVDSGANQLVDGDGEDALVRPVPQAVLQTLSRAGDE
FSRLYQQDFRQISGLLHLTPSTVRPRFAAVVEELFHDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIVGWMTEYLNR
HLQNWIQEQGGWCWASLELVQTGHASTPCKLQHLTWPWRGSQSNYSQGRTH
>gnl|bcl2dbpro|A0A8C5MT36_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Leptobrachium leishanense GN=BCL-2 (length=296 residues).
MAHPRRAGYDHRDIVVKYIHYKLSQRGYEWEDGRQQVSVDLQDASAANNNHSDGDEVSASPGDPLGPRHDTPLNAAASTS
NNASQNNAPTALLDNAPAAQRSSASAASTVPSPQGVLNVTQGNSNVDSGANQLVDGDGEDALVRPVPQAVLQTLSRAGDE
FSRLYQQDFRQISGLLHLTPSTVRPRFAAVVEELFHDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIVGWMTEYLNR
HLQNWIQEQGGWESFVELYDSSVRPPFDPSWISIKTILSLAVVGACITIGAYLGHK
>gnl|bcl2dbpro|A0A8C5MT36_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Leptobrachium leishanense GN=BCL-2 (length=273 residues).
MAHPRRAGYDHRDIVVKYIHYKLSQRGYEWEDGRQQVSVDLQDASAANNNHSDGDEVSASPGDPLGPRHDTPLNAAASTS
NNASQNNAPTALLDNAPAAQRSSASAASTVPSPQGVLNVTQGNSNVDSGANQLVDGDGEDALVRPVPQAVLQTLSRAGDE
FSRLYQQDFRQISGLLHLTPSTVRPRFAAVVEELFHDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIVGWMTEYLNR
HLQNWIQEQGGWVSFFNLFYIHFLVEASFIDAQ
>gnl|bcl2dbpro|A0A8C5MT36_BCL2-03 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Leptobrachium leishanense GN=BCL-2 (length=295 residues).
MAHPRRAGYDHRDIVVKYIHYKLSQRGYEWEDGRQQVSVDLQDASAANNNHSDGDEVSASPGDPLGPRHDTPLNAAASTS
NNASQNNAPTALLDNAPAAQRSSASAASTVPSPQGVLNVTQGNSNVDSGANQLVDGDGEDALVRPVPQAVLQTLSRAGDE
FSRLYQQDFRQISGLLHLTPSTVRPRFAAVVEELFHDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIVGWMTEYLNR
HLQNWIQEQGGWLNTLPEIETLQSLIRETQRSLRQSHRKNECTWIKRAQRILTHS
© 1998-2022Legal notice