Dataset for protein BCL-2-like of organism Laticauda laticaudata

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfnkktmvlycggspglapaapqspgggggggsegglallpggvrgglggglcwppagcaegpraligggsragplslig
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                    . :.   :     :              
-------------------------------------------msssn----rtlvldyiayklsqag------------
ppdadaraligqaalppatpeeeldgcepeaetgvepsvhsssrpyypglyvnsvtvrlvksycrerqyswveisgdren
                                     maapgiaepg fdpl qi qqflh i q kald ra e  g e
                                            d        e          a   ha         d

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                       . *                         . ..*  . ..        :     .: :
--p--g---g-gg-l--------psPspav--aa-----------------vyetLrragdefsrryqraftqmvsqlhi
vt-sv-tmp-s--v-qglspswhal nk--tn--sthphpvpqvsdgpqaaarsv cqvcssiqlkvrlnlspytrsvql
rselsqeggalsklvn glgrfg c aevesglraieealleel        l  k   damkehegd rglsgk g 
qe ak dfc g  f          a  a  na                    a    e     ee      qd ld    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       . :  *  : * **  *****:::: **. :.    .      :  ::  ::  :      *:  :..*   :
-tpvtayssfsqVveelFrDG-vNWGRIvtffsFGgmlcvesvsremsslvstiaewmteylvthlrpWiqdnggWvsgw
hslgedrqlmne mtqe n  kt     lalil  aivakklqgpnqrpnlkslsyiiatvmtstkhn lshhna -rlf
 dked lni ma ann  a  ii       i e   f   h kdklakggigr  tf  inre gk  le    dn  
  ia  gkh                         a       i  ee  dq          e  de         e  

       330       340       350       360        
....:....|....:....|....:....|....:....|....:...
:          *         ..                         
lt--------vF-------svwn--v-la-l-grglyvgyvfr-----
vnlqgkglqrs hvedlegtlrgsw-s--t-stlirsrfsqwnqyhsd
ik        k        ei  ktlrfssvk k aclehligipdl 
 c        f         d  il a  f a g  a ag  d     
© 1998-2022Legal notice