Dataset for protein BCL-2-like of organism Laticauda laticaudata

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C5RX62_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Laticauda laticaudata GN=BCL2L1 (length=227 residues).
MSSGNRSLVVDFIAYKLAQRGHSWREIEGDGEERTELSGEMGGSSGVLNGGSPSWHPSPSPVVNGAASIHPALLEELSDG
PQAAVRQTLREAGDEFELRYRRAFSDLTSQLHITLGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMRG
LVGRIATWMATYLTEHLDPWIQDNGGWVSLWLNLQGKGLQRVFSLWGKTLRLAFLSGGGRCREGVWG
>gnl|bcl2dbpro|A0A8C5S4J3_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Laticauda laticaudata GN=BCL-2 (length=205 residues).
MAHPGIRDYSNREIVLRYIHYKLSQKGYDWVASGDRENVSPAVGTFPALGGLVPLPSAAVSNLAATEEHPVPQVVYSTLC
QAGDEFSRRYQRDFTQMSGQLHLTPVTARSHFMAVVEELFRDGVNWGRIVAFFEFGGMLCVESVSREMSPLVDSIAEWMT
EYMNRHLHNWIQDNGGWVRGWLCSFTVWGGRGLYVGHQFDIPDLD
>gnl|bcl2dbpro|A0A8C5SDG4_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Laticauda laticaudata GN=BCL2A1 (length=173 residues).
MESYNFLYVNTLVQDYLKYICQEAQLAAAPNKVAEVLRKAGSSAQKEVEGNLRPYVDSLGIHSIEEAGNIFNQVMENEFA
DGKINWGRILTIFLFGGILAKKLQGPLAKENLKQISYFITDYIVSTKGKWISENGGWDNGFITKFEDRNSWVSLSTLKTK
ILAVFSVFNQYHS
>gnl|bcl2dbpro|A0A8C5WWU9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Laticauda laticaudata GN=MCL-1 (length=325 residues).
MFNKKTMVLYCGGSPGLAPAAPQSPGGGGGGGSEGGLALLPGGVRGGLGGGLCWPPAGCAEGPRALIGGGSRAGPLSLIG
PPDADARALIGQAALPPATPEEELDGCEPEAETGVEPSVASSSAPPSPGDPLRQVTLQLVASYLREAADQEPSKQDGCGG
GKFLQGLLGRFGPCPAEAETAARALETLRRVCDDIMEKHQLAFQGMLRKVQIDKADDLKLMSEVATQLFNDGITNWGRIV
TLISFGAFVAKHLKSINQESGISTLAEIITEVLVTEKREWLLHHNAWEGFVKFFHVEDLEGSIRNILVAFASVAGLGASL
AYLIR
© 1998-2022Legal notice