Dataset for protein BCL-2-like of organism Laticauda laticaudata

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5WWU9_MCL1-01      MFNKKTMVLYCGGSPGLAPAAPQSPGGGGGGGSEGGLALLPGGVRGGLGG
A0A8C5SDG4_BCL2A1-      --------------------------------------------------
A0A8C5RX62_BCL2L1-      --------------------------------------------------
A0A8C5S4J3_BCL2-01      --------------------------------------------------
                                                                          

A0A8C5WWU9_MCL1-01      GLCWPPAGCAEGPRALIGGGSRAGPLSLIGPPDADARALIGQAALPPATP
A0A8C5SDG4_BCL2A1-      --------------------------------------------------
A0A8C5RX62_BCL2L1-      --------------------------------------------------
A0A8C5S4J3_BCL2-01      --------------------------------------------------
                                                                          

A0A8C5WWU9_MCL1-01      EEELDGCEPEAETGVEPSVASSSAPPSPGDPLRQVTLQLVASYLREAA--
A0A8C5SDG4_BCL2A1-      -----------------------MESYNFLYVNTLVQDYLKYICQEAQLA
A0A8C5RX62_BCL2L1-      -----------------------MSSGN----RSLVVDFIAYKLAQRGHS
A0A8C5S4J3_BCL2-01      -----------------MAHPGIRDYSN----REIVLRYIHYKLSQKGYD
                                                        . :.   :     :    

A0A8C5WWU9_MCL1-01      ---------DQEPSKQDGCGGGKFLQGLLGRFGPCPAEAETAAR------
A0A8C5SDG4_BCL2A1-      ---------------------------------AAPNK------------
A0A8C5RX62_BCL2L1-      WREIEGDGEERTELSGEMGGSSGVLNGGSPSWHPSPSPVVNGAASIHPAL
A0A8C5S4J3_BCL2-01      WVA-SGDRENVSPAVGTFPALGGLV--------PLPSAAVSNLAATEEHP
                                                         . *              

A0A8C5WWU9_MCL1-01      -----------ALETLRRVCDDIMEKHQLAFQGMLRKVQI-DKADDLKLM
A0A8C5SDG4_BCL2A1-      -----------VAEVLRKAGSSAQKEVEGNLRPYVDSLGIHSIEEAGNIF
A0A8C5RX62_BCL2L1-      LEELSDGPQAAVRQTLREAGDEFELRYRRAFSDLTSQLHI-TLGTAYQSF
A0A8C5S4J3_BCL2-01      VPQV-------VYSTLCQAGDEFSRRYQRDFTQMSGQLHL-TPVTARSHF
                                   . ..*  . ..        :     .: :       . :

A0A8C5WWU9_MCL1-01      SEVATQLFNDGITNWGRIVTLISFGAFVAKHLKSINQESGISTLAEIITE
A0A8C5SDG4_BCL2A1-      NQVMENEFADGKINWGRILTIFLFGGILAKKLQGPLAKENLKQISYFITD
A0A8C5RX62_BCL2L1-      EQVVNELFRDG-VNWGRIVAFFSFGGALCVESVDKEMRGLVGRIATWMAT
A0A8C5S4J3_BCL2-01      MAVVEELFRDG-VNWGRIVAFFEFGGMLCVESVSREMSPLVDSIAEWMTE
                          *  : * **  *****:::: **. :.    .      :  ::  :: 

A0A8C5WWU9_MCL1-01      VLVTEKREWLLHHNAW-EGFVK--------FFHVEDLEGSIRNILVAFAS
A0A8C5SDG4_BCL2A1-      YIVSTKGKWISENGGWDNGFIT--------KF-------EDRNSWVSLST
A0A8C5RX62_BCL2L1-      YLTEHLDPWIQDNGGWVSLWLNLQGKGLQRVF-------SLWGKTLRLAF
A0A8C5S4J3_BCL2-01      YMNRHLHNWIQDNGGWVRGWLC--------SF-------TVWG-------
                         :      *:  :..*   ::          *         ..       

A0A8C5WWU9_MCL1-01      VAGLGASLAYLIR-----
A0A8C5SDG4_BCL2A1-      LKTKILAVFSVFNQYHS-
A0A8C5RX62_BCL2L1-      LSGGGRCREGVWG-----
A0A8C5S4J3_BCL2-01      --GRGLYVGHQFDIPDLD
                                          

© 1998-2022Legal notice