Dataset for protein BCL-2-like of organism Lates calcarifer

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       :       .                                           :   .     .          
mniipttkrvalmncyklsqrgvaeglhyssgdss----------srngnvgspkrpknlevsstngypaksr-------
--sysnreltvfyisfi-p-nnyp-------d---pqiamgstidrt------s-----ivtrcrs--rsgppledsdvd
 smsqwkntlekfekh- -k----wshmrvr-ppn          --e skvn-sptnr llnangtgnctqq       
 mcgl   i   a d       hvtrclnpneegg          and gitg peseg chh  epfa p d       
 a ec                   ln dele ada              dea  aae   a c  d              

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                          .:     ::   .   *  :                                  
--slpctpelrsdseidvsscpagdevlrndtrqlesqfmrdFtgls--------------------------------n
dgg----sp-q---------ysevkaamedsadefillyqqa sdmhkprwnkskalptmkrvvdgvlekhryayngmis
  -tesv-- -rrrnpsttppe shr   rigqdm trhtpr hs a                                r
  dn pa n  qqll qpggld ia    ea n   r  aa   e                                  q
   a              d ia                                                          

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 *              : .::. **  ****: .:. * ..:.     .                     : : :: ** 
qLsltdrtddvsfvsvv-kelfgDG-vNWGRiaslfaFggvvcvhlker-------------grvdcvdlvgqwiatYLl
k yidptgayrrslrkmadnvvr  tt    vvgfvt tatlaqecvakrlgldprqgqelgqmsslcsriaeemtv  d
t lrqsgp qq  kn ime   k  rl     ia  e   a  rq q qe            netpq rnlvdt  m  n
  h  cd  ph  ee                               a               e pgn ge      e  g
  d   a   c  a                                                d  e          d   

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     *: .:..*: * ::           .          .            :                         
sdqrdWlvknngWdgFveffhvsdpestvrs-------tliglagfagigatllllik----------------------
erisp iqsqgs er akiygqdreaesrsnwetmktwlgvaatlvtsvvvgvavaqrsypaarvfglqdkhnthsglrs
nplqs  le   c c lsdrqaavvhsc rpsirrvv l vl lglltl symvr-rs   celvcka agrercikr
ghkn   kd     a      aa  snfd  qk f k f a m  a  ali f itksql    c             fp
 e k                       a   m                    a     nf                    

       330       340     
....:....|....:....|....:
                         
-------------------------
kwsvmspwsiepidkpriicmdstl
fllrhk i                 
ciapag                   
                         
© 1998-2020Legal notice