Dataset for protein BCL-2-like of organism Lates calcarifer

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W6FHH7_BCL2L10      MSCGLWKETLVLAEDY----------------------------------
A0A4W6CDF4_MCL1-03      MNIIPTTKRTALMNCFILPQNGVAEGLHYSSGDSSPQIAMGSTIDSRNGN
A0A4W6CDF4_MCL1-02      MNIIPTTKRTALMNCFILPQNGVAEGLHYSSGDSSPQIAMGSTIDSRNGN
A0A4W6CDF4_MCL1-01      MNIIPTTKRTALMNCFILPQNGVAEGLHYSSGDSSPQIAMGSTIDSRNGN
A0A4W6DDI0_BCL2-01      MASECNRNIVEKYICHKLSKRGYVWRCDNVRDEDA----------ANNGS
A0A4W6BQD5_BCL2L1-      --MSQNRELVVFYIKYKLSQRNYPLNHMELNEPPN----------RTDGG
A0A4W6EST2_BCL2L1-      -MSYSNRELVEFFISYKLSQRNHPTSLLRPEDAGG----------RTEGD
                               :       .                                  

A0A4W6FHH7_BCL2L10      ---------LCLCCTSPGPAPPP---------------------------
A0A4W6CDF4_MCL1-03      VGSPKRPKNLEVSSTNGYPAKSRLEDSDVDDGSLPCTPELQSDSEIDVSS
A0A4W6CDF4_MCL1-02      VGSPKRPKNLEVSSTNGYPAKSRLEDSDVDDGSLPCTPELQSDSEIDVSS
A0A4W6CDF4_MCL1-01      VGSPKRPKNLEVSSTNGYPAKSRLEDSDVDDGSLPCTPELQSDSEIDVSS
A0A4W6DDI0_BCL2-01      IVSPPPT--LVHRCRE--ASGPD---------DNESVPNLRRRLNPQPDP
A0A4W6BQD5_BCL2L1-      EAGSSEEERIATHANGTFNSTSP---------GTPPASPLRQQRLPSTTS
A0A4W6EST2_BCL2L1-      KTNSAASNGLLVNSRD--RCGQQ---------GAP--SPLR-------GG
                                 :   .     .                              

A0A4W6FHH7_BCL2L10      PSESAAAMRRIAQDMETQHQARFHSLA-----------------------
A0A4W6CDF4_MCL1-03      CPAGDEVLENDTRQLISQFMRDFTGLSKPRWNKSKALPTMKRVVDGVLEK
A0A4W6CDF4_MCL1-02      CPAGDEVLENDTRQLISQFMRDFTGLSKPRWNKSKALPTMKRVVDGVLEK
A0A4W6CDF4_MCL1-01      CPAGDEVLENDTRQLISQFMRDFTGLSKPRWNKSKALPTMKRVVDGVLEK
A0A4W6DDI0_BCL2-01      YAAIHRVLREAGDELERLYQPDFTEMS-----------------------
A0A4W6BQD5_BCL2L1-      LDAVKEALRDSANEFELRYARAFSDLH-----------------------
A0A4W6EST2_BCL2L1-      IEAVKAALRDSADEFELLFTQAFSDLS-----------------------
                              .:     ::   .   *  :                        

A0A4W6FHH7_BCL2L10      ---------QTLLRQCGPDPCSSLRKVMEELVGDGRLNWGRVVSLFTFTG
A0A4W6CDF4_MCL1-03      HRYAYNGMINKLSLDDRGDDVSFVSVVAKNLFGDGTTNWGRIASLVAFGA
A0A4W6CDF4_MCL1-02      HRYAYNGMINKLSLDDRGDDVSFVSVVAKNLFGDGTTNWGRIASLVAFGA
A0A4W6CDF4_MCL1-01      HRYAYNGMINKLSLDDRGDDVSFVSVVAKNLFGDGTTNWGRIASLVAFGA
A0A4W6DDI0_BCL2-01      ---------RQLYLTSTTAQRRFAEVI-DELFRDG-VNWGRIIAFFEFGG
A0A4W6BQD5_BCL2L1-      ---------NQLHITPATAYQSFENVM-DEVFRDG-VNWGRIIGLFAFGG
A0A4W6EST2_BCL2L1-      ---------SQLDITPDTAYHSFKSVM-DEVFKDG-VNWGRIVGLFAFGG
                                   *              : .::. **  ****: .:. * .

A0A4W6FHH7_BCL2L10      VLARQLQEQRLGLDPRQGQELGQEPGNCRELAETIADYLGEEKKDWLLEN
A0A4W6CDF4_MCL1-03      VVCQHLKER-------------GRVDCVDLVGQEIATYLLSDQRDWLVKN
A0A4W6CDF4_MCL1-02      VVCQHLKER-------------GRVDCVDLVGQEIATYLLSDQRDWLVKN
A0A4W6CDF4_MCL1-01      VVCQHLKER-------------GRVDCVDLVGQEIATYLLSDQRDWLVKN
A0A4W6DDI0_BCL2-01      TVCVECAAKE------------DMTSQVDNIAEWMTEYLNGPLNSWIKDN
A0A4W6BQD5_BCL2L1-      ALCVECVEK-------------EMSPLVGRIVEWMTVYLDNHIQPWIQSQ
A0A4W6EST2_BCL2L1-      VLCVECVEK-------------NMSELVSRIADWMTMYLDERISPWIQSQ
                        .:.     .                     : : :: **      *: .:

A0A4W6FHH7_BCL2L10      DGWEGFCKFSHAAREVNHDSSMKT----VLVAAAGVGLAGLTFLMVR---
A0A4W6CDF4_MCL1-03      NSWDGFVEFFHVSDPESTVRN-------TLIGLAGFAGIGATLALLISNY
A0A4W6CDF4_MCL1-02      NSWDGFVEFFHVSDPESTVRN-------TLIGLAGFAGIGATLALLIRSS
A0A4W6CDF4_MCL1-01      NSWDGFVEFFHVSDPESTVRN-------TLIGLAGFAGIGATLALLIRSF
A0A4W6DDI0_BCL2-01      GGWDAFVELYDRQRESVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK--
A0A4W6BQD5_BCL2L1-      GGWERFAEIFGQDAAAESRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
A0A4W6EST2_BCL2L1-      GGWDCFAEIFGQDAAAEARRSRETMRRWLLVGVALLTGVLVGVLVAKKQ-
                        ..*: * ::           .          .            :     

A0A4W6FHH7_BCL2L10      ---------------------------------------------
A0A4W6CDF4_MCL1-03      PAARVFVCKAKAGRESCIFPCLAVMKPISIEPIDKPRIICMDSTL
A0A4W6CDF4_MCL1-02      ---RCLGLQDKHNTHRGLRRKWSRASPW-----------------
A0A4W6CDF4_MCL1-01      ---CEFG--------SGLKSFILPHG-------------------
A0A4W6DDI0_BCL2-01      ---------------------------------------------
A0A4W6BQD5_BCL2L1-      ---------------------------------------------
A0A4W6EST2_BCL2L1-      ---------------------------------------------
                                                                     

© 1998-2020Legal notice