Dataset for protein BCL-2-like of organism Lates calcarifer

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A4W6BQD5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Lates calcarifer GN=BCL2L1 (length=232 residues).
MSQNRELVVFYIKYKLSQRNYPLNHMELNEPPNRTDGGEAGSSEEERIATHANGTFNSTSPGTPPASPLRQQRLPSTTSL
DAVKEALRDSANEFELRYARAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIIGLFAFGGALCVECVEKEMSPLV
GRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQDAAAESRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A4W6CDF4_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Lates calcarifer GN=MCL-1 (length=305 residues).
MNIIPTTKRTALMNCFILPQNGVAEGLHYSSGDSSPQIAMGSTIDSRNGNVGSPKRPKNLEVSSTNGYPAKSRLEDSDVD
DGSLPCTPELQSDSEIDVSSCPAGDEVLENDTRQLISQFMRDFTGLSKPRWNKSKALPTMKRVVDGVLEKHRYAYNGMIN
KLSLDDRGDDVSFVSVVAKNLFGDGTTNWGRIASLVAFGAVVCQHLKERGRVDCVDLVGQEIATYLLSDQRDWLVKNNSW
DGFVEFFHVSDPESTVRNTLIGLAGFAGIGATLALLIRSSRCLGLQDKHNTHRGLRRKWSRASPW
>gnl|bcl2dbpro|A0A4W6CDF4_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Lates calcarifer GN=MCL-1 (length=295 residues).
MNIIPTTKRTALMNCFILPQNGVAEGLHYSSGDSSPQIAMGSTIDSRNGNVGSPKRPKNLEVSSTNGYPAKSRLEDSDVD
DGSLPCTPELQSDSEIDVSSCPAGDEVLENDTRQLISQFMRDFTGLSKPRWNKSKALPTMKRVVDGVLEKHRYAYNGMIN
KLSLDDRGDDVSFVSVVAKNLFGDGTTNWGRIASLVAFGAVVCQHLKERGRVDCVDLVGQEIATYLLSDQRDWLVKNNSW
DGFVEFFHVSDPESTVRNTLIGLAGFAGIGATLALLIRSFCEFGSGLKSFILPHG
>gnl|bcl2dbpro|A0A4W6CDF4_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Lates calcarifer GN=MCL-1 (length=325 residues).
MNIIPTTKRTALMNCFILPQNGVAEGLHYSSGDSSPQIAMGSTIDSRNGNVGSPKRPKNLEVSSTNGYPAKSRLEDSDVD
DGSLPCTPELQSDSEIDVSSCPAGDEVLENDTRQLISQFMRDFTGLSKPRWNKSKALPTMKRVVDGVLEKHRYAYNGMIN
KLSLDDRGDDVSFVSVVAKNLFGDGTTNWGRIASLVAFGAVVCQHLKERGRVDCVDLVGQEIATYLLSDQRDWLVKNNSW
DGFVEFFHVSDPESTVRNTLIGLAGFAGIGATLALLISNYPAARVFVCKAKAGRESCIFPCLAVMKPISIEPIDKPRIIC
MDSTL
>gnl|bcl2dbpro|A0A4W6DDI0_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Lates calcarifer GN=BCL-2 (length=229 residues).
MASECNRNIVEKYICHKLSKRGYVWRCDNVRDEDAANNGSIVSPPPTLVHRCREASGPDDNESVPNLRRRLNPQPDPYAA
IHRVLREAGDELERLYQPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECAAKEDMTSQVD
NIAEWMTEYLNGPLNSWIKDNGGWDAFVELYDRQRESVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A4W6EST2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Lates calcarifer GN=BCL2L1 (length=221 residues).
MSYSNRELVEFFISYKLSQRNHPTSLLRPEDAGGRTEGDKTNSAASNGLLVNSRDRCGQQGAPSPLRGGIEAVKAALRDS
ADEFELLFTQAFSDLSSQLDITPDTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVECVEKNMSELVSRIADWMTMY
LDERISPWIQSQGGWDCFAEIFGQDAAAEARRSRETMRRWLLVGVALLTGVLVGVLVAKKQ
>gnl|bcl2dbpro|A0A4W6FHH7_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Lates calcarifer GN=BCL2L10 (length=191 residues).
MSCGLWKETLVLAEDYLCLCCTSPGPAPPPPSESAAAMRRIAQDMETQHQARFHSLAQTLLRQCGPDPCSSLRKVMEELV
GDGRLNWGRVVSLFTFTGVLARQLQEQRLGLDPRQGQELGQEPGNCRELAETIADYLGEEKKDWLLENDGWEGFCKFSHA
AREVNHDSSMKTVLVAAAGVGLAGLTFLMVR
© 1998-2020Legal notice