Dataset for protein BCL-2-like of organism Junco hyemalis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             :   ::                                                             
------rgydnreivlkyvhyklsq-gy-w---e---------------mavalagtssdht-pvsphveppgsaaasha
mahpgrmlllaaalivdfillly--r--d-pas-draslspglsapaaaavspaispk-lklg-gahvp--g--sgigkc
  metaeysyvyyfaqa ls v   k  s sql eedenrtdfageede--------- --- a-----vt- a------
       f s     i   q                              dgv n sp w a  t  i   n  tvhqss
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
        .   :    *   . :.      .       :   : :      .  .  *:.:                  
ppaeglrpap-vvhlvlRqagdefsr-----ryqrdfaqmsgqlhltpstaysr-fvaVveelfr---------------
iaiscykqgaqfitria denkllqtkkeiektsvndkpvvlcisvdvlkdreqiven lkqaqeklgpvdmlvncagts
-qvhhigr qtr rqa  tmass el     q realsdltsr di svavaq nq mn k ad              
lee e      d a    e      e       e   r  ld          k    g  d                   
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
           .: *:::.  :*..         :            :::                              
--------dgvnwgRivaffefGgvmcvesvnrems---hlvdsiaawmteylnrqlhnwiqdnggw-------------
vtgkfedievnsfe lmtvnyl saypsraqiatvkltaerrmgrivfvssqagq------------erglglfgytays
        gnt       i t    ltkkl vkg r   vekkr vy i t itnnkdp  de     nfvd y nd aa
                    s          eh  q      eq ss      idh ad   a       f         
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
ptkfalrglaealqmevkpynvyvtvayppdtdtpgfaeesktkpletklisetspnnleenkqtyfsvcqaeqvarviv
emrkgqetfnkw ltgatvaeanaalq   apsageiqaagggrr  gvpalqg             cm ecvr c cvt
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------l--------------slktilslvlvgs-i-------
kdaiqgnfnssvgsdgymlsiltsgmspvtsiteglqqdvfve-ygngmrplldfswi---gcswvsyrseycflhhtpy
nikvp   qpeq  gsvpp laht trerqelpcsiyrvagmgvtkrtwqsfftltkgtvlr ivslrqrav-       
                                   ssgstclaifcfer l  s     a p fncganncty       
                                      r     a                l ag f l  ld       
                                                                  c f  f        
                                                                       c        

       410       420       
....:....|....:....|....:..
                           
---------vlgaylghk---------
mnlinkwlit--------wsrsadkte
       sf-srsvmqrttqe      
       peqr grg grk        
       caam fmf  eg        
          g clc  a         
                           
© 1998-2023Legal notice