Dataset for protein BCL-2-like of organism Junco hyemalis

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A8C5IH35_BCL2-04 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Junco hyemalis GN=BCL-2 (length=245 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWPASEDRASLSPGLSAPAAAAAVAAAGTSSDHTGPVSPHPEPPGSAAASHA
PPAEGLRPAPQVVHLVLRQAGDEFSRRYQRDFAQMSGQLHLTPLTARSRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSHLVDSIAAWMTEYLNRQLHNWIQDNGGWSYRRTGLAVACRTWQLFLTLTWGTLKGCSWCGRNNCVCLAVMGSL
FGHTT
>gnl|bcl2dbpro|A0A8C5IH35_BCL2-05 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Junco hyemalis GN=BCL-2 (length=241 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWPASEDRASLSPGLSAPAAAAAVAAAGTSSDHTGPVSPHPEPPGSAAASHA
PPAEGLRPAPQVVHLVLRQAGDEFSRRYQRDFAQMSGQLHLTPLTARSRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSHLVDSIAAWMTEYLNRQLHNWIQDNGGWISGSVSVKGCFNSCARSSTCFLHHTPYMNLINKWLFQSGFVCGHA
W
>gnl|bcl2dbpro|A0A8C5IH35_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Junco hyemalis GN=BCL-2 (length=337 residues).
MLLLAAAFIVAFVLLLYMVSPLISPKSLKLPGAHVVVTGGSSGIGKCIAIECYKQGAFITLIARDENKLLQTKKEIEKYS
VNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGPVDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATM
KERRMGRIVFVSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNVYVTVAYPPDTDTPGFAEESKTKPLETKLISE
TSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITEGLQQDAFVELYGNGMRPLFDFSWISLKTILS
LVLVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A8C5IH35_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Junco hyemalis GN=BCL-2 (length=332 residues).
MLLLAAAFIVAFVLLLYMVSPLISPKSLKLPGAHVVVTGGSSGIGKCIAIECYKQGAFITLIARDENKLLQTKKEIEKYS
VNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGPVDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATM
KERRMGRIVFVSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNVYVTVAYPPDTDTPGFAEESKTKPLETKLISE
TSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITEGLQQVVCMGIFRIIGLFYLGSFDSIVRRCMM
QREKSESADKTE
>gnl|bcl2dbpro|A0A8C5IH35_BCL2-03 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Junco hyemalis GN=BCL-2 (length=239 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWPASEDRASLSPGLSAPAAAAAVAAAGTSSDHTGPVSPHPEPPGSAAASHA
PPAEGLRPAPQVVHLVLRQAGDEFSRRYQRDFAQMSGQLHLTPLTARSRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSHLVDSIAAWMTEYLNRQLHNWIQDNGGWDAFVELYGNGMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A8C5J3C4_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Junco hyemalis GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVARVLRTMASSLQEQTEEALRPLLDRIDITSVAVAKRIFNGVMDEKFA
DGNTNWGRIMTIFTFGGVLTKKLQEHGVQLTAEEKEQISYFITEYIINNKADWIDANGGWENGFLTKFERRSLLSFSKIT
ALLIAVVSLFREYY
>gnl|bcl2dbpro|A0A8C5JFI3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Junco hyemalis GN=BCL2L1 (length=336 residues).
MYSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAGEEDEMDGVLNGSPSWHAATSHIVNGATVHQSSLEVHEIRRA
ADVRQALREAGDEFELRYRRAFSDLTSQLHITPSTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVVKEMRVLV
KRIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEMRKGQETFNKWLLTGATVAEANAALQPPAPSAGEIQAAGGG
RRLEGVPALQGSPNNLEENKQTYFCMCECVRVCRCVTNIKVPQPEQGSGSVPPSLAHTGTRERQELPCSIPILSLLLQSE
LIPEAGGGRGGGRGQR
© 1998-2022Legal notice