Dataset for protein BCL-2-like of organism Junco hyemalis

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5J3C4_BCL2A1-      --METAEFYYVYYLAQDYLQYVL---------------------------
A0A8C5IH35_BCL2-04      MAHPGRRGYDNREIVLKYIHYKLSQRGYDWPASEDRASLSPGLSAPAAAA
A0A8C5IH35_BCL2-05      MAHPGRRGYDNREIVLKYIHYKLSQRGYDWPASEDRASLSPGLSAPAAAA
A0A8C5IH35_BCL2-03      MAHPGRRGYDNREIVLKYIHYKLSQRGYDWPASEDRASLSPGLSAPAAAA
A0A8C5JFI3_BCL2L1-      ------MYSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAGEEDEM
A0A8C5IH35_BCL2-01      ------MLLLAAAFIVAFVLLLY--------------------------M
A0A8C5IH35_BCL2-02      ------MLLLAAAFIVAFVLLLY--------------------------M
                                     :   ::                               

A0A8C5J3C4_BCL2A1-      -------------------------------QESHLGPAQTRVARVLRTM
A0A8C5IH35_BCL2-04      AVAAAGTSSDHTGPVSPHPEPPGSAAASHAPPAEGLRPAPQVVHLVLRQA
A0A8C5IH35_BCL2-05      AVAAAGTSSDHTGPVSPHPEPPGSAAASHAPPAEGLRPAPQVVHLVLRQA
A0A8C5IH35_BCL2-03      AVAAAGTSSDHTGPVSPHPEPPGSAAASHAPPAEGLRPAPQVVHLVLRQA
A0A8C5JFI3_BCL2L1-      DGVLNGSPSWHA-ATSHIV--NGATVHQSSLEVHEIRRAA-DVRQALREA
A0A8C5IH35_BCL2-01      VSPLISPKSLKL-PGAHVVVTGGSSGIGKCIAIECYKQGA-FITLIARDE
A0A8C5IH35_BCL2-02      VSPLISPKSLKL-PGAHVVVTGGSSGIGKCIAIECYKQGA-FITLIARDE
                                                              .   :    *  

A0A8C5J3C4_BCL2A1-      ASSLQE-----QTEEALRPLLDRIDITSVAVAKRIFNGVMDEKFAD----
A0A8C5IH35_BCL2-04      GDEFSR-----RYQRDFAQMSGQLHLTPLTARSR-FVAVVEELFR-----
A0A8C5IH35_BCL2-05      GDEFSR-----RYQRDFAQMSGQLHLTPLTARSR-FVAVVEELFR-----
A0A8C5IH35_BCL2-03      GDEFSR-----RYQRDFAQMSGQLHLTPLTARSR-FVAVVEELFR-----
A0A8C5JFI3_BCL2L1-      GDEFEL-----RYRRAFSDLTSQLHITPSTAYQS-FEQVVNELFR-----
A0A8C5IH35_BCL2-01      NKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQ-VENVLKQAQEKLGPV
A0A8C5IH35_BCL2-02      NKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQ-VENVLKQAQEKLGPV
                         . :.      .       :   : :      .  .  *:.:        

A0A8C5J3C4_BCL2A1-      ------------------GNTNWGRIMTIFTFGGVLTKKLQEHGVQLTAE
A0A8C5IH35_BCL2-04      ------------------DGVNWGRIVAFFEFGGVMCVESVNREMS---H
A0A8C5IH35_BCL2-05      ------------------DGVNWGRIVAFFEFGGVMCVESVNREMS---H
A0A8C5IH35_BCL2-03      ------------------DGVNWGRIVAFFEFGGVMCVESVNREMS---H
A0A8C5JFI3_BCL2L1-      ------------------DGVNWGRIVAFFSFGGALCVESVVKEMR---V
A0A8C5IH35_BCL2-01      DMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMK---E
A0A8C5IH35_BCL2-02      DMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMK---E
                                             .: *:::.  :*..         :     

A0A8C5J3C4_BCL2A1-      EKEQISYFITEYIINNKADWIDANGGWE----------------------
A0A8C5IH35_BCL2-04      LVDSIAAWMTEYLNRQLHNWIQDNGGWSYRRTGLAVACRT----------
A0A8C5IH35_BCL2-05      LVDSIAAWMTEYLNRQLHNWIQDNGGWI-----------S----------
A0A8C5IH35_BCL2-03      LVDSIAAWMTEYLNRQLHNWIQDNGGWD-----------A----------
A0A8C5JFI3_BCL2L1-      LVKRIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEMRKGQETFN
A0A8C5IH35_BCL2-01      RRMGRIVFVSSQAGQ---------------LGLFGYTAYSPTKFALRGLA
A0A8C5IH35_BCL2-02      RRMGRIVFVSSQAGQ---------------LGLFGYTAYSPTKFALRGLA
                               :::                                        

A0A8C5J3C4_BCL2A1-      --------------------------------------------------
A0A8C5IH35_BCL2-04      --------------------------------------------------
A0A8C5IH35_BCL2-05      --------------------------------------------------
A0A8C5IH35_BCL2-03      --------------------------------------------------
A0A8C5JFI3_BCL2L1-      KWLLTGATVAEANAALQ-PPAPSAGEIQAAGGGRRLEGVPALQGSPNNLE
A0A8C5IH35_BCL2-01      EALQMEVKPYNVYVTVAYPPDTDTPGFAEESKTKPLETKLISETS-----
A0A8C5IH35_BCL2-02      EALQMEVKPYNVYVTVAYPPDTDTPGFAEESKTKPLETKLISETS-----
                                                                          

A0A8C5J3C4_BCL2A1-      --------------------------------------------------
A0A8C5IH35_BCL2-04      --------------------------------------------------
A0A8C5IH35_BCL2-05      --------------------------------------------------
A0A8C5IH35_BCL2-03      --------------------------------------------------
A0A8C5JFI3_BCL2L1-      ENKQTYFCMCECVRVCRCVTNIKVP---QPEQGSGSVPPSLAHTGTRERQ
A0A8C5IH35_BCL2-01      -------SVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVT
A0A8C5IH35_BCL2-02      -------SVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVT
                                                                          

A0A8C5J3C4_BCL2A1-      ----------NGFLTKFERRSLLSFSKITALLIAVVSLFREYY-------
A0A8C5IH35_BCL2-04      ----------WQLFLTLTWGTLKGCSWCGRNNCVCLAVMGSLF-------
A0A8C5IH35_BCL2-05      ----------GSVSVKGCFNSCARSSTCFLHHTPYMNLINKWLFQSGFVC
A0A8C5IH35_BCL2-03      ----------FVELYGNGMRPLFDFSWISLKTILSLVLVGACITLGAYL-
A0A8C5JFI3_BCL2L1-      ELPCSI-------------------------PILSLLLQSELIPEAGGGR
A0A8C5IH35_BCL2-01      SITEGLQQDAFVELYGNGMRPLFDFSWISLKTILSLVLVGA--CITLGAY
A0A8C5IH35_BCL2-02      SITEGLQQVVCMGIF----------------RIIGLFYLGSFDSIVRRCM
                                                           :              

A0A8C5J3C4_BCL2A1-      -------------
A0A8C5IH35_BCL2-04      GHTT---------
A0A8C5IH35_BCL2-05      GHAW---------
A0A8C5IH35_BCL2-03      GHK----------
A0A8C5JFI3_BCL2L1-      GGGRGQR------
A0A8C5IH35_BCL2-01      LGHK---------
A0A8C5IH35_BCL2-02      MQREKSESADKTE
                                     

© 1998-2022Legal notice