Dataset for protein Bcl-2 of organism Junco hyemalis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                     :  *      .  :*:        * *  :  :.*                     .:.
---------------------mahPgrrgydnreiVl--------KyIhyklsqrGy--------------------dwp
mlllaaafivafvlllymvsplis kslklpgahv vtggssgig c aiecykq afitliardenkllqtkkeiekys
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
..:... *. .:...     *  .   :.:: ***.   : .*::.                                  
asedrasLspglsapaaaaaVaaa-gtssdhtGPVsphpeppGsaa----------------------------------
vndkqvv cisvdvskdyeq envlkqaqekl   dmlvnca tsvtgkfedievnsferlmavnylgsvypsraviatm
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                       ::::*.  .**  .:.::: :.  .  .:  *  *     **: *    * * * : 
-----------------------ashaPpaegLRpapqvvhlvlrqagdefsrrYqrD-----FAqmSgqlhL-TpLtar
kerrmgrivfvssqagqlglfgytays tkfa  glaealqmevkpynvyvtva pp tdtpg  ee ktkp e k ise
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:  *. .*:: *                *:  :::: ::.  *.*  .:* . *.  :    . . *             
srfVavvEelfRdgvnwgrivaffefggVmcvesvnremshlVdSiaawMteyLnrqlhnwiqdngGwq-----------
tss cqa qva ---------------- ivkdaiqgnfnss g -dgy lsi tsgmspvtsite lsqvrtglavacr
                                                                    iyr         
                                                                    d d         

       330       340       350       360       370     
....:....|....:....|....:....|....:....|....:....|....:
                          :  :.    :        .          
afvelygngmrplfdfswislktilslvlvgs--citlgayl-ghk---------
vwsvsv------------c---rtvymnymnafdwl------cqrtwsesadkte
tgqliltltwntckrs t-grnncpg fvl k  sfvrsgmv   et        
scmgffkgcfgs agc   f hh ic i    l fqrcfm   ak        
© 1998-2022Legal notice