Dataset for protein Bcl-2 of organism Junco hyemalis

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A8C5IH35_BCL2-04 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Junco hyemalis GN=BCL-2 (length=245 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWPASEDRASLSPGLSAPAAAAAVAAAGTSSDHTGPVSPHPEPPGSAAASHA
PPAEGLRPAPQVVHLVLRQAGDEFSRRYQRDFAQMSGQLHLTPLTARSRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSHLVDSIAAWMTEYLNRQLHNWIQDNGGWSYRRTGLAVACRTWQLFLTLTWGTLKGCSWCGRNNCVCLAVMGSL
FGHTT
>gnl|bcl2dbpro|A0A8C5IH35_BCL2-05 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Junco hyemalis GN=BCL-2 (length=241 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWPASEDRASLSPGLSAPAAAAAVAAAGTSSDHTGPVSPHPEPPGSAAASHA
PPAEGLRPAPQVVHLVLRQAGDEFSRRYQRDFAQMSGQLHLTPLTARSRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSHLVDSIAAWMTEYLNRQLHNWIQDNGGWISGSVSVKGCFNSCARSSTCFLHHTPYMNLINKWLFQSGFVCGHA
W
>gnl|bcl2dbpro|A0A8C5IH35_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Junco hyemalis GN=BCL-2 (length=337 residues).
MLLLAAAFIVAFVLLLYMVSPLISPKSLKLPGAHVVVTGGSSGIGKCIAIECYKQGAFITLIARDENKLLQTKKEIEKYS
VNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGPVDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATM
KERRMGRIVFVSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNVYVTVAYPPDTDTPGFAEESKTKPLETKLISE
TSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITEGLQQDAFVELYGNGMRPLFDFSWISLKTILS
LVLVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A8C5IH35_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Junco hyemalis GN=BCL-2 (length=332 residues).
MLLLAAAFIVAFVLLLYMVSPLISPKSLKLPGAHVVVTGGSSGIGKCIAIECYKQGAFITLIARDENKLLQTKKEIEKYS
VNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGPVDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATM
KERRMGRIVFVSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNVYVTVAYPPDTDTPGFAEESKTKPLETKLISE
TSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITEGLQQVVCMGIFRIIGLFYLGSFDSIVRRCMM
QREKSESADKTE
>gnl|bcl2dbpro|A0A8C5IH35_BCL2-03 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Junco hyemalis GN=BCL-2 (length=239 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWPASEDRASLSPGLSAPAAAAAVAAAGTSSDHTGPVSPHPEPPGSAAASHA
PPAEGLRPAPQVVHLVLRQAGDEFSRRYQRDFAQMSGQLHLTPLTARSRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSHLVDSIAAWMTEYLNRQLHNWIQDNGGWDAFVELYGNGMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
© 1998-2022Legal notice