Dataset for protein Bcl-2 of organism Junco hyemalis

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5IH35_BCL2-01      MLLLAAAFIVAFVLLLYMVSPLISPKSLKLPGAHVVVTGGSSGIGKCIAI
A0A8C5IH35_BCL2-02      MLLLAAAFIVAFVLLLYMVSPLISPKSLKLPGAHVVVTGGSSGIGKCIAI
A0A8C5IH35_BCL2-04      ---------------------MAHPGRRGYDNREIVL--------KYIHY
A0A8C5IH35_BCL2-05      ---------------------MAHPGRRGYDNREIVL--------KYIHY
A0A8C5IH35_BCL2-03      ---------------------MAHPGRRGYDNREIVL--------KYIHY
                                             :  *      .  :*:        * *  

A0A8C5IH35_BCL2-01      ECYKQGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQ
A0A8C5IH35_BCL2-02      ECYKQGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQ
A0A8C5IH35_BCL2-04      KLSQRGY--------------------DWPASEDRASLSPGLSAPAAAAA
A0A8C5IH35_BCL2-05      KLSQRGY--------------------DWPASEDRASLSPGLSAPAAAAA
A0A8C5IH35_BCL2-03      KLSQRGY--------------------DWPASEDRASLSPGLSAPAAAAA
                        :  :.*                     .:...:... *. .:...     

A0A8C5IH35_BCL2-01      VENVLKQAQEKLGPVDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSV
A0A8C5IH35_BCL2-02      VENVLKQAQEKLGPVDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSV
A0A8C5IH35_BCL2-04      VAAA-GTSSDHTGPVSPHPEPPGSAA------------------------
A0A8C5IH35_BCL2-05      VAAA-GTSSDHTGPVSPHPEPPGSAA------------------------
A0A8C5IH35_BCL2-03      VAAA-GTSSDHTGPVSPHPEPPGSAA------------------------
                        *  .   :.:: ***.   : .*::.                        

A0A8C5IH35_BCL2-01      YPSRAVIATMKERRMGRIVFVSSQAGQLGLFGYTAYSPTKFALRGLAEAL
A0A8C5IH35_BCL2-02      YPSRAVIATMKERRMGRIVFVSSQAGQLGLFGYTAYSPTKFALRGLAEAL
A0A8C5IH35_BCL2-04      ---------------------------------ASHAPPAEGLRPAPQVV
A0A8C5IH35_BCL2-05      ---------------------------------ASHAPPAEGLRPAPQVV
A0A8C5IH35_BCL2-03      ---------------------------------ASHAPPAEGLRPAPQVV
                                                         ::::*.  .**  .:.:

A0A8C5IH35_BCL2-01      QMEVKPYNVYVTVAYPPDTDTPGFAEESKTKPLETKLISETSSVCQAEQV
A0A8C5IH35_BCL2-02      QMEVKPYNVYVTVAYPPDTDTPGFAEESKTKPLETKLISETSSVCQAEQV
A0A8C5IH35_BCL2-04      HLVLRQAGDEFSRRYQRD-----FAQMSGQLHL-TPLTARSRFVAVVEEL
A0A8C5IH35_BCL2-05      HLVLRQAGDEFSRRYQRD-----FAQMSGQLHL-TPLTARSRFVAVVEEL
A0A8C5IH35_BCL2-03      HLVLRQAGDEFSRRYQRD-----FAQMSGQLHL-TPLTARSRFVAVVEEL
                        :: :.  .  .:  *  *     **: *    * * * : :  *. .*::

A0A8C5IH35_BCL2-01      AR----------------VIVKDAIQGNFNSSVGS-DGYMLSILTSGMSP
A0A8C5IH35_BCL2-02      AR----------------VIVKDAIQGNFNSSVGS-DGYMLSILTSGMSP
A0A8C5IH35_BCL2-04      FRDGVNWGRIVAFFEFGGVMCVESVNREMSHLVDSIAAWMTEYLNRQLHN
A0A8C5IH35_BCL2-05      FRDGVNWGRIVAFFEFGGVMCVESVNREMSHLVDSIAAWMTEYLNRQLHN
A0A8C5IH35_BCL2-03      FRDGVNWGRIVAFFEFGGVMCVESVNREMSHLVDSIAAWMTEYLNRQLHN
                         *                *:  :::: ::.  *.*  .:* . *.  :  

A0A8C5IH35_BCL2-01      VTSITEGLQQD---------AFVELYGNGMRPLFDFSWISLKTILSLVLV
A0A8C5IH35_BCL2-02      VTSITEGLQQV---------VCMGIF----------------RIIGLFYL
A0A8C5IH35_BCL2-04      WIQDNGGWSYRRTGLAVACRTWQLFLTLTWGTLKGCSWCGRNNCVCLAVM
A0A8C5IH35_BCL2-05      WIQDNGGWI-----------SGSVSVKGCFNSCARSSTCFLHHTPYMNLI
A0A8C5IH35_BCL2-03      WIQDNGGWD-----------AFVELYGNGMRPLFDFSWISLKTILSLVLV
                          . . *                                       :  :

A0A8C5IH35_BCL2-01      GA--CITLGAYL-GHK---------
A0A8C5IH35_BCL2-02      GSFDSIVRRCMM-QREKSESADKTE
A0A8C5IH35_BCL2-04      GS--LF-------GHTT--------
A0A8C5IH35_BCL2-05      NK--WLFQSGFVCGHAW--------
A0A8C5IH35_BCL2-03      GA--CITLGAYL-GHK---------
                        .    :        .          

© 1998-2022Legal notice