Dataset for protein Mcl-1 of organism Ictalurus punctatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                  :.  :* *:: .: . *                             
-----------------pkdlsltvpnvssgykekplavVaPfqrpilnlGissenqrglsdgslptspevdcdevlgvg
mcaqlnaengnlsmmls----------------metaql n lktalsra -----------------------------
               fg                                                               

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                :*:**. :*:*    :   *****************************
cflehntreiiadflllftspsrplgrhrkvlqTmKCvvdGlLvkhelvykGMLAKLCLDERGDDMSVISSVATELFSDG
--------------------------------n l  arq v pgtgf---                             
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
VTNWGRIASLLAFGAVVSKYEMESGRGHCPSIVAEEISSYLLFNQKEWLLKNNSWDGFVEFFHVPDPESSVRSALTTIVT
                                                                                
                                                                                

       250   
....:....|...
*************
VAGIGAVLAYLTR
             
             
© 1998-2020Legal notice