Dataset for protein Mcl-1 of organism Ictalurus punctatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2D0RCW7_MCL1-02      ---------------------------------METAQLVNPLKTALSRA
A0A2D0RCW7_MCL1-03      MCAQLNAENGNLSMMFSPKDLSLTVPNVSSGYKEKPLAVVAPFQRPILNL
A0A2D0RCW7_MCL1-01      ---------------LGPKDLSLTVPNVSSGYKEKPLAVVAPFQRPILNL
                                                          :.  :* *:: .: . 

A0A2D0RCW7_MCL1-02      G-------------------------------------------------
A0A2D0RCW7_MCL1-03      GISSENQRGLSDGSLPTSPEVDCDEVLGVGCFLEHNTREIIADFLLLFTS
A0A2D0RCW7_MCL1-01      GISSENQRGLSDGSLPTSPEVDCDEVLGVGCFLEHNTREIIADFLLLFTS
                        *                                                 

A0A2D0RCW7_MCL1-02      ------------NTLKCARQGVLPGTGF---GMLAKLCLDERGDDMSVIS
A0A2D0RCW7_MCL1-03      PSRPLGRHRKVLQTMKCVVDGLLVKHELVYKGMLAKLCLDERGDDMSVIS
A0A2D0RCW7_MCL1-01      PSRPLGRHRKVLQTMKCVVDGLLVKHELVYKGMLAKLCLDERGDDMSVIS
                                    :*:**. :*:*    :   *******************

A0A2D0RCW7_MCL1-02      SVATELFSDGVTNWGRIASLLAFGAVVSKYEMESGRGHCPSIVAEEISSY
A0A2D0RCW7_MCL1-03      SVATELFSDGVTNWGRIASLLAFGAVVSKYEMESGRGHCPSIVAEEISSY
A0A2D0RCW7_MCL1-01      SVATELFSDGVTNWGRIASLLAFGAVVSKYEMESGRGHCPSIVAEEISSY
                        **************************************************

A0A2D0RCW7_MCL1-02      LLFNQKEWLLKNNSWDGFVEFFHVPDPESSVRSALTTIVTVAGIGAVLAY
A0A2D0RCW7_MCL1-03      LLFNQKEWLLKNNSWDGFVEFFHVPDPESSVRSALTTIVTVAGIGAVLAY
A0A2D0RCW7_MCL1-01      LLFNQKEWLLKNNSWDGFVEFFHVPDPESSVRSALTTIVTVAGIGAVLAY
                        **************************************************

A0A2D0RCW7_MCL1-02      LTR
A0A2D0RCW7_MCL1-03      LTR
A0A2D0RCW7_MCL1-01      LTR
                        ***

© 1998-2020Legal notice