Dataset for protein Mcl-1 of organism Ictalurus punctatus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A2D0RCW7_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Ictalurus punctatus GN=MCL-1 (length=253 residues).
MCAQLNAENGNLSMMFSPKDLSLTVPNVSSGYKEKPLAVVAPFQRPILNLGISSENQRGLSDGSLPTSPEVDCDEVLGVG
CFLEHNTREIIADFLLLFTSPSRPLGRHRKVLQTMKCVVDGLLVKHELVYKGMLAKLCLDERGDDMSVISSVATELFSDG
VTNWGRIASLLAFGAVVSKYEMESGRGHCPSIVAEEISSYLLFNQKEWLLKNNSWDGFVEFFHVPDPESSVRSALTTIVT
VAGIGAVLAYLTR
>gnl|bcl2dbpro|A0A2D0RCW7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Ictalurus punctatus GN=MCL-1 (length=238 residues).
LGPKDLSLTVPNVSSGYKEKPLAVVAPFQRPILNLGISSENQRGLSDGSLPTSPEVDCDEVLGVGCFLEHNTREIIADFL
LLFTSPSRPLGRHRKVLQTMKCVVDGLLVKHELVYKGMLAKLCLDERGDDMSVISSVATELFSDGVTNWGRIASLLAFGA
VVSKYEMESGRGHCPSIVAEEISSYLLFNQKEWLLKNNSWDGFVEFFHVPDPESSVRSALTTIVTVAGIGAVLAYLTR
>gnl|bcl2dbpro|A0A2D0RCW7_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Ictalurus punctatus GN=MCL-1 (length=156 residues).
METAQLVNPLKTALSRAGNTLKCARQGVLPGTGFGMLAKLCLDERGDDMSVISSVATELFSDGVTNWGRIASLLAFGAVV
SKYEMESGRGHCPSIVAEEISSYLLFNQKEWLLKNNSWDGFVEFFHVPDPESSVRSALTTIVTVAGIGAVLAYLTR
© 1998-2020Legal notice