Dataset for protein Bcl-w of organism Homo sapiens

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
matpasapdtralvadfvgyklrqkgyvcgagpgegpaadplhqamraagdefetrfrrtfsdlaaqlhvtpgsaqqrft
--------------------------------------------------------------------------------
                                                         x                      

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
qvsdelfqggpnwgrlvaffvfgaalcaesvnkemeplvgqvqewmvayletqladwihssggw----------------
----------------------------------------------------------------aeftalygdgaleear
                                                                                

       170       180       190       200       210       220    
....:....|....:....|....:....|....:....|....:....|....:....|....
                                                                
----------------------------------------------------------------
rlregnwasvrtvltgavalgalvwvtlftlssttghisllafpgtfsqeelqgpwpgyqnall
                        tsga fapk                               
© 1998-2020Legal notice