Dataset for protein Bcl-w of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7I2V383_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
A0A7I2V383_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
A0A7I2V383_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
Q92843_BCL2L2-09        MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
Q92843_BCL2L2-01        MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
Q92843_BCL2L2-10        --------------------------------------------------
Q92843_BCL2L2-07        MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
Q92843_BCL2L2-04        MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
Q92843_BCL2L2-08        MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
Q92843_BCL2L2-02        MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
Q92843_BCL2L2-03        MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
Q92843_BCL2L2-05        MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
Q92843_BCL2L2-06        MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
                                                                          

A0A7I2V383_BCL2L2-      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
A0A7I2V383_BCL2L2-      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
A0A7I2V383_BCL2L2-      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
Q92843_BCL2L2-09        DEFETRFRRTFSDLAAQLHVT-----------------------------
Q92843_BCL2L2-01        D-------------------------------------------------
Q92843_BCL2L2-10        -------XRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
Q92843_BCL2L2-07        DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
Q92843_BCL2L2-04        DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
Q92843_BCL2L2-08        DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
Q92843_BCL2L2-02        DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
Q92843_BCL2L2-03        DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
Q92843_BCL2L2-05        DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
Q92843_BCL2L2-06        DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
                                                                          

A0A7I2V383_BCL2L2-      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGW------
A0A7I2V383_BCL2L2-      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGW------
A0A7I2V383_BCL2L2-      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWLSQITE
Q92843_BCL2L2-09        --------------------------------------------------
Q92843_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-10        VFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGW------
Q92843_BCL2L2-07        VFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGW------
Q92843_BCL2L2-04        VFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGW------
Q92843_BCL2L2-08        VFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGW------
Q92843_BCL2L2-02        VFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGW------
Q92843_BCL2L2-03        VFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGW------
Q92843_BCL2L2-05        VFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGW------
Q92843_BCL2L2-06        VFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGW------
                                                                          

A0A7I2V383_BCL2L2-      --------------------------ELEAIKARVREMEEEAEKLKELQN
A0A7I2V383_BCL2L2-      --------------------------ELEAIKARVREMEEEAEKLKELQN
A0A7I2V383_BCL2L2-      AEMADEVICSEILSDCDSAASSPDLEELEAIKARVREMEEEAEKLKELQN
Q92843_BCL2L2-09        --------------------------------------------------
Q92843_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-10        ------------------------------------------AEFTALYG
Q92843_BCL2L2-07        ------------------------------------------VRSFSIAA
Q92843_BCL2L2-04        ------------------------------------------V-------
Q92843_BCL2L2-08        ------------------------------------------AEFTALYG
Q92843_BCL2L2-02        ------------------------------------------AEFTALYG
Q92843_BCL2L2-03        ------------------------------------------AEFTALYG
Q92843_BCL2L2-05        ------------------------------------------AEFTALYG
Q92843_BCL2L2-06        ------------------------------------------AEFTALYG
                                                                          

A0A7I2V383_BCL2L2-      EVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAH
A0A7I2V383_BCL2L2-      EVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAH
A0A7I2V383_BCL2L2-      EVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAH
Q92843_BCL2L2-09        --------------------------------------------------
Q92843_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-10        DGALEEARRLREGNWASV------------RTVLTGAVALGALVWSTLFT
Q92843_BCL2L2-07        LHILLQSWS-PGGRWGL---------------------------------
Q92843_BCL2L2-04        --------------WSTL------------FTLPSTTGHISLLA------
Q92843_BCL2L2-08        DGALEEARRLREGNWASV------------RTVLTGAVALGALV------
Q92843_BCL2L2-02        DGALEEARRLREGNWASV------------RTVLTGAVALGALV------
Q92843_BCL2L2-03        DGALEEARRLREGNWASV------------RTVLTGAVALGALV------
Q92843_BCL2L2-05        DGALEEARRLREGNWASV------------RTVLTGAVALGALV------
Q92843_BCL2L2-06        DGALEEARRLREGNWASV------------RTVLTGAVALGALV------
                                                                          

A0A7I2V383_BCL2L2-      FHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQ
A0A7I2V383_BCL2L2-      FHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQ
A0A7I2V383_BCL2L2-      FHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQ
Q92843_BCL2L2-09        --------------------------------------------------
Q92843_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-10        LPSTTGHISLLAFPGTFSQEELQGPWPGYQNALL----------------
Q92843_BCL2L2-07        --------------------------------------------------
Q92843_BCL2L2-04        ------------FPGTFSQEELQGPWPGYQNALL----------------
Q92843_BCL2L2-08        ------------TVGAFFASK-----------------------------
Q92843_BCL2L2-02        ------------TVGAFFASK-----------------------------
Q92843_BCL2L2-03        ------------TVGAFFASK-----------------------------
Q92843_BCL2L2-05        ------------TVGAFFASK-----------------------------
Q92843_BCL2L2-06        ------------TVGAFFASK-----------------------------
                                                                          

A0A7I2V383_BCL2L2-      IKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGR
A0A7I2V383_BCL2L2-      IKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGR
A0A7I2V383_BCL2L2-      IKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGR
Q92843_BCL2L2-09        --------------------------------------------------
Q92843_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-10        --------------------------------------------------
Q92843_BCL2L2-07        --------------------------------------------------
Q92843_BCL2L2-04        --------------------------------------------------
Q92843_BCL2L2-08        --------------------------------------------------
Q92843_BCL2L2-02        --------------------------------------------------
Q92843_BCL2L2-03        --------------------------------------------------
Q92843_BCL2L2-05        --------------------------------------------------
Q92843_BCL2L2-06        --------------------------------------------------
                                                                          

A0A7I2V383_BCL2L2-      VYRGRARATSWYSPY
A0A7I2V383_BCL2L2-      VYRGRARATSWYSPY
A0A7I2V383_BCL2L2-      VYRGRARATSWYSPY
Q92843_BCL2L2-09        ---------------
Q92843_BCL2L2-01        ---------------
Q92843_BCL2L2-10        ---------------
Q92843_BCL2L2-07        ---------------
Q92843_BCL2L2-04        ---------------
Q92843_BCL2L2-08        ---------------
Q92843_BCL2L2-02        ---------------
Q92843_BCL2L2-03        ---------------
Q92843_BCL2L2-05        ---------------
Q92843_BCL2L2-06        ---------------
                                       

© 1998-2021Legal notice