Dataset for protein Bcl-w of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q92843_BCL2L2-01      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
Q92843_BCL2L2-05      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
Q92843_BCL2L2-06      --------------------------------------------------
Q92843_BCL2L2-02      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
Q92843_BCL2L2-03      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
Q92843_BCL2L2-04      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
                                                                        

Q92843_BCL2L2-01      D-------------------------------------------------
Q92843_BCL2L2-05      DEFETRFRRTFSDLAAQLHVT-----------------------------
Q92843_BCL2L2-06      -------XRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
Q92843_BCL2L2-02      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
Q92843_BCL2L2-03      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
Q92843_BCL2L2-04      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
                                                                        

Q92843_BCL2L2-01      --------------------------------------------------
Q92843_BCL2L2-05      --------------------------------------------------
Q92843_BCL2L2-06      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTAL
Q92843_BCL2L2-02      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTAL
Q92843_BCL2L2-03      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTA-
Q92843_BCL2L2-04      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGW------
                                                                        

Q92843_BCL2L2-01      --------------------------------------------------
Q92843_BCL2L2-05      --------------------------------------------------
Q92843_BCL2L2-06      YGDGALEEARRLREGNWASVRTVLTGAVALGALVWSTLFTLPSTTGHISL
Q92843_BCL2L2-02      YGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK-------
Q92843_BCL2L2-03      --------------------------------------------------
Q92843_BCL2L2-04      --------------------------------------------------
                                                                        

Q92843_BCL2L2-01      ------------------------
Q92843_BCL2L2-05      ------------------------
Q92843_BCL2L2-06      LAFPGTFSQEELQGPWPGYQNALL
Q92843_BCL2L2-02      ------------------------
Q92843_BCL2L2-03      ------------------------
Q92843_BCL2L2-04      ------------------------
                                              

© 1998-2020Legal notice