Dataset for protein Bcl-w of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q92843_BCL2L2-09      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
Q92843_BCL2L2-01      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
Q92843_BCL2L2-10      --------------------------------------------------
Q92843_BCL2L2-07      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
Q92843_BCL2L2-04      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
Q92843_BCL2L2-02      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
Q92843_BCL2L2-03      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
Q92843_BCL2L2-05      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
Q92843_BCL2L2-06      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
Q92843_BCL2L2-08      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
                                                                        

Q92843_BCL2L2-09      DEFETRFRRTFSDLAAQLHVT-----------------------------
Q92843_BCL2L2-01      D-------------------------------------------------
Q92843_BCL2L2-10      -------XRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
Q92843_BCL2L2-07      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
Q92843_BCL2L2-04      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
Q92843_BCL2L2-02      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
Q92843_BCL2L2-03      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
Q92843_BCL2L2-05      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
Q92843_BCL2L2-06      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
Q92843_BCL2L2-08      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
                                                                        

Q92843_BCL2L2-09      --------------------------------------------------
Q92843_BCL2L2-01      --------------------------------------------------
Q92843_BCL2L2-10      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTAL
Q92843_BCL2L2-07      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWVRSFSI
Q92843_BCL2L2-04      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWV-----
Q92843_BCL2L2-02      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTAL
Q92843_BCL2L2-03      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTAL
Q92843_BCL2L2-05      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTAL
Q92843_BCL2L2-06      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTAL
Q92843_BCL2L2-08      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTAL
                                                                        

Q92843_BCL2L2-09      --------------------------------------------------
Q92843_BCL2L2-01      --------------------------------------------------
Q92843_BCL2L2-10      YGDGALEEARRLREGNWASVRTVLTGAVALGALVWSTLFTLPSTTGHISL
Q92843_BCL2L2-07      AALHILLQSWS-PGGRWGL-------------------------------
Q92843_BCL2L2-04      ----------------WSTLFTLPSTTGHISLLA----------------
Q92843_BCL2L2-02      YGDGALEEARRLREGNWASVRTVLTGAVALGALV----------------
Q92843_BCL2L2-03      YGDGALEEARRLREGNWASVRTVLTGAVALGALV----------------
Q92843_BCL2L2-05      YGDGALEEARRLREGNWASVRTVLTGAVALGALV----------------
Q92843_BCL2L2-06      YGDGALEEARRLREGNWASVRTVLTGAVALGALV----------------
Q92843_BCL2L2-08      YGDGALEEARRLREGNWASVRTVLTGAVALGALV----------------
                                                                        

Q92843_BCL2L2-09      ------------------------
Q92843_BCL2L2-01      ------------------------
Q92843_BCL2L2-10      LAFPGTFSQEELQGPWPGYQNALL
Q92843_BCL2L2-07      ------------------------
Q92843_BCL2L2-04      --FPGTFSQEELQGPWPGYQNALL
Q92843_BCL2L2-02      --TVGAFFASK-------------
Q92843_BCL2L2-03      --TVGAFFASK-------------
Q92843_BCL2L2-05      --TVGAFFASK-------------
Q92843_BCL2L2-06      --TVGAFFASK-------------
Q92843_BCL2L2-08      --TVGAFFASK-------------
                                              

© 1998-2021Legal notice