Dataset for protein Bcl-w of organism Homo sapiens

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|Q92843_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Homo sapiens GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|Q92843_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Homo sapiens GN=BCL2L2 (length=51 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGD
>gnl|bcl2dbpro|Q92843_BCL2L2-03 BCL2-like 2 protein OS=[Eukaryota] Homo sapiens GN=BCL2L2 (length=149 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTA
>gnl|bcl2dbpro|Q92843_BCL2L2-04 BCL2-like 2 protein OS=[Eukaryota] Homo sapiens GN=BCL2L2 (length=144 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGW
>gnl|bcl2dbpro|Q92843_BCL2L2-05 BCL2-like 2 protein OS=[Eukaryota] Homo sapiens GN=BCL2L2 (length=71 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVT
>gnl|bcl2dbpro|Q92843_BCL2L2-06 BCL2-like 2 protein OS=[Eukaryota] Homo sapiens GN=BCL2L2 (length=167 residues).
XRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADW
IHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVWSTLFTLPSTTGHISLLAFPGTFSQEELQGPWP
GYQNALL
© 1998-2020Legal notice