Dataset for protein Bcl-2 of organism Hippocampus comes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***************************** ::                                 .**************
MANERNRTIVENYICHKLSKRGYAWGFGAgeed--------------------------------kRSHGSDPLADIHRV
                             eddaaaanngllvapsptlvlrcreassgperdcapd              

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
LREAGDELERLYQPDFTEMSRQLYLSSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECATKEDMTSQVDNIAE
                                                                                

       170       180       190       200       210       220     
....:....|....:....|....:....|....:....|....:....|....:....|....:
*****************************************************************
WMTEYLNGPLGSWIQDNGGWDAFVELYDRQRDSVFSCTWPSIKTVFGLAALGAASLTIGAYLTQK
                                                                 
© 1998-2020Legal notice