Dataset for protein Bcl-2 of organism Hippocampus comes

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q2XQX2_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Hippocampus comes GN=BCL-2 (length=193 residues).
MANERNRTIVENYICHKLSKRGYAWGFGAGEEDDRSHGSDPLADIHRVLREAGDELERLYQPDFTEMSRQLYLSSTTAQR
RFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECATKEDMTSQVDNIAEWMTEYLNGPLGSWIQDNGGWDAFVELYDRQRD
SVFSCTWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A3Q2XQX2_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Hippocampus comes GN=BCL-2 (length=225 residues).
MANERNRTIVENYICHKLSKRGYAWGFGAEDDAAAANNGLLVAPSPTLVLRCREASSGPERDCAPKRSHGSDPLADIHRV
LREAGDELERLYQPDFTEMSRQLYLSSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECATKEDMTSQVDNIAE
WMTEYLNGPLGSWIQDNGGWDAFVELYDRQRDSVFSCTWPSIKTVFGLAALGAASLTIGAYLTQK
© 1998-2020Legal notice