Dataset for protein Bcl-2 of organism Hippocampus comes

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2XQX2_BCL2-01      MANERNRTIVENYICHKLSKRGYAWGFGAEDDAAAANNGLLVAPSPTLVL
A0A3Q2XQX2_BCL2-02      MANERNRTIVENYICHKLSKRGYAWGFGAGEED-----------------
                        ***************************** ::                  

A0A3Q2XQX2_BCL2-01      RCREASSGPERDCAPKRSHGSDPLADIHRVLREAGDELERLYQPDFTEMS
A0A3Q2XQX2_BCL2-02      ---------------DRSHGSDPLADIHRVLREAGDELERLYQPDFTEMS
                                       .**********************************

A0A3Q2XQX2_BCL2-01      RQLYLSSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECATKED
A0A3Q2XQX2_BCL2-02      RQLYLSSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECATKED
                        **************************************************

A0A3Q2XQX2_BCL2-01      MTSQVDNIAEWMTEYLNGPLGSWIQDNGGWDAFVELYDRQRDSVFSCTWP
A0A3Q2XQX2_BCL2-02      MTSQVDNIAEWMTEYLNGPLGSWIQDNGGWDAFVELYDRQRDSVFSCTWP
                        **************************************************

A0A3Q2XQX2_BCL2-01      SIKTVFGLAALGAASLTIGAYLTQK
A0A3Q2XQX2_BCL2-02      SIKTVFGLAALGAASLTIGAYLTQK
                        *************************

© 1998-2022Legal notice