Dataset for protein BCL-2-like of organism Gopherus evgoodei

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------p-------------g-rsw-srgselryvryl----------
mlalkrnaviglnlytrgkptqptvlpwsssgegtrts-gpaaegvrpatli-r---snnsivyk-pyp-vssssysrsl
            mkfcgag slhpsana p  adipph           s fagagygmeehsegfihaelgppaaapg 
                                   maa               f   dd  g  c a   i         

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                           :    
--------------------------lsqrgy-w--------------------e--e--s---------g-ps-hqglk
vaqgsrvgplwrpeqsldgcdpdaer------s-ssnpstppaegedelrtlyq-sr-pv-rylsppvpt-t--wqkyas
s g pdpclds g ee         lmgpp adggrl       dd  idgdsadnlgmi pn reaten ssggkdl m
                         k      a aaf                  ea la       aal g  d a   

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :   .                 .   .  .*  ... .       :      : :.        .  *    * **  *
yllsgprg---a--------lrpaptrvlqaLrragdefsrryrrafsqmlsqlhitpvtayrs-ftqVvtelFrDGv-N
svvqeaq-ssp-snvplgdh---pmskarlv cqvasgvqlknqislqpltrtfdlksgddrqrivva mnkv s  nt 
ripp  p hgns     eagegv aqg aht  h   flikehhed kgcsgk    nf  lk    aehe a     
h  n  a aaa              ea  e   e     ee  e   ad  d      e  ag       d         

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****:::: **. :.    .   .        :   :*  :      *:  : **  *  .:                  
WGRIvtffsFGgvlcvesvsremqvl---vntiaywmTeylvthlrpWiqnngGWesFvelyg--------rn----fn-
    lalim  aivskklqnkrvsptgenkkslvvii tvitrtkhn lveqr  vr sdvfyvndlegss--vrvvnhf
      i e   fma h keinqenc   igr ssf   nng de  ed    dg  af r e aaaki kmqpq d 
            a      dh   l     dq  g      id  ad   a     a                glea a 

       330       340       
....:....|....:....|....:..
        ::       :         
swlslgatls-----ymmt--------
rliltstsfalinvgkvlrlgsylsrk
gfagrkei   alffgcil  al gh 
       e       a ff        
© 1998-2022Legal notice